Вход в личный кабинет | Регистрация
Избранное (0) Список сравнения (0)
Ваши покупки:
0 товаров на 0 Р
Итого: 0 Р Купить

Аминокислоты для роста: «Какие аминокислоты нужны для роста мышц?» – Яндекс.Кью

Содержание

Аминокислоты для волос: полный гид по добавкам

Красота и прочность волос зависит от кератина — специального белка, который составляет 80% от структуры волос.

Неполноценное питание, температурные перепады, окрашивание — факторы, которые разрушают кератин, а вместе с этим ухудшается состояние волос. Косметические средства могут визуально исправить проблему, но они не устранят ее на корню.

Для того, чтобы улучшить ситуацию важно “действовать изнутри”.

В производстве кератина главную роль играют 4 аминокислоты: цистеин, лизин, аргинин и метионин, из которых две являются незаменимыми (метионин и лизин) и две (цистеин и аргинин) — заменимыми.


Незаменимые аминокислоты — те аминокислоты, которые не могут синтезироваться в нашем организме и их мы получаем из рациона и специальных добавок (как отдельно, так и в составе комплексных аминокислот или протеина). Заменимые аминокислоты — те, что вырабатываются в нашем организме при условии, что вы питаетесь сбалансировано.

Цистеин

24% кератина состоит из цистеина — заменимой аминокислоты, которую организм синтезирует из метионина. Аминокислота защищает фолликулы от окислительного стресса, насыщает волосы серой, которая в свою очередь улучшает их структуру и прочность.

Аргинин

Аргинин улучшает циркуляцию крови, что увеличивает приток крови к корням волос и повышает количество питательных веществ, которые поступают в фолликулы. Также дополнительный прием аргинина часто используют при лечении выпадения волос.

Метионин

Метионин влияет на объем стержня волоса (или проще говоря на его толщину), питает и предотвращает ломкость и выпадение волос. Аминокислота является источником серы, которая в свою очередь необходима для синтеза цистеина, о котором говорилось выше.

Лизин

Лизин — незаменимая аминокислота, известная своим противовирусным воздействием. Но помимо успешного применения лизина в лечении вируса герпеса, этот компонент играет важную роль в синтезе коллагена. Дополнительный прием лизина помогает в восстановлении поврежденных волос, формировании здоровых фолликул, а также стимулирует рост волос.


Как принимать аминокислоты для волос

Лучшим вариантом является прием комплекса всех вышеперечисленных аминокислот, но если такой возможности нет, то можно приобрести их отдельно и принимать вместе раз в день между приемами пищи. Курс может длится до 3-х месяцев, который можно повторять 2 раза в год.

Что еще полезно для волос

В дополнение к аминокислотам нельзя не упомянуть о витаминах, минералах и различных природных соединениях, которые также играют важную роль в создании красивой, густой шевелюры.

  • Витамины A и E поддерживают здоровье волосяных фолликул и регулируют выработку кожного сала.
  • Витамин C стимулирует выработку коллагена.
  • Цинк принимает участие в выработке кератина и коллагена, улучшает структуру волос и препятствует их выпадению.
  • Омега-3 имеет важное значение для роста клеток и кровообращения, незаменимые жирные кислоты питают волосяные фолликулы, обеспечивая их естественным увлажнением.

Лейцин и его влияние на рост мышц.

Незаменимая аминокислота L-Leucine
▶️Образование новых мышечных клеток
▶️Выработка гормона роста
▶️Регенерация разрушенных мышечных клеток
▶️Сжигание жира

Известно, что употребление большого количества белка насыщает организм аминокислотами, которые необходимы для роста мышечной массы. Однако стоит уточнить, что некоторые незаменимые аминокислоты влияют на образование новых мышечных клеток в большей степени, чем остальные. Такой аминокислотой и является лейцин.

Лейцин – это одна из аминокислот ВСАА, уникальным свойством которой является способность стимулировать синтез мышечного белка. На самом деле она воздействует на рост мышечной массы в 10 раз больше любой другой аминокислоты. Данный эффект не раз изучался в научных лабораториях.

В одном из исследований, опубликованном в журнале про питание Journal of Nutrition, утверждается, что лейцин, попадая в организм, активирует внутриклеточный сигнальный комплекс mTOR. Данный комплекс подает сигнал ядру клетки о том, что среда в организме подходит для образования новых мышечных клеток. Было установлено, что чем больше лейцина содержится в организме, тем активнее действует mTOR, следовательно, быстрее растут мышцы.

Кроме того, исследования показали, что добавление небольшой порции лейцина в обычный рацион в сочетании с регулярными тренировками помогает значительно быстрее набрать сухую мышечную массу, а также уменьшить процент жира в организме. Последний эффект связан с тем, что лейцин стимулирует выработку гормона роста в организме, который и помогает сжигать лишний жир для выработки энергии.

Комплекс SAN Performance Leucine поможет стимулировать образование новых мышечных тканей куда быстрее, чем любая другая аминокислота. Каждая порция из 5 г лейцина ускорит процессы роста и регенерации мышечных клеток, от чего тело станет более мускулистым и рельефным. Лейцин в продукте представлен в форме быстрорастворимого порошка, что способствует его скорейшему усвоению, следовательно, практически мгновенному влиянию на сигнальный путь mTOR, дающий команду к началу синтеза мышечных клеток. А благодаря влиянию на гормональный фон лейцин также способствует уменьшению жировой ткани.

Аргинин и гормон роста.: Инновационная косметика GRS

Аргинин является главным источником оксида азота (NO) в организме и все его биологические функции связаны именно с этим. При приеме аминокислоты аргинин в виде пищевой добавки, через 25 – 30 минут из желудка аргинин всасывается в кровь, затем поступает в печень, в которой при помощи ферментов расщепляется на оксид азота (NO) и орнитин.

В организме аргинин присутствует в свободном виде и в составе белков (много аргинина в протаминах).

Оксид азота и аргинин - этой теме посвященны многочисленные исследования биологов, которые установли, что молекула окиси азота является универсальным биологическим агентом.

 

Аргинин и гормон роста.

Многочисленные исследования установили, что дополнительный прием аргинина стимулирует выработку гормона роста. Внутривенное вливание 15-30 граммов аргинина используется как стандартный эндокринологический тест, провоцирующий гипофиз на выделение гормона роста.

Многочисленные исследования показали широкий диапазон воздействия аргинина на гормон роста от никакого до потрясающего синергического всплеска гормона роста.

В результате экспериментов установлено снижение реакции гормона роста на аргинин у 30-34-летних людей по сравнению с 18-21-летними. В этих возрастных группах наивысшую реакцию гормона роста на аргинин имели люди с низким содержанием жиров в теле и высокой аэробной способностью. Дозы составляли 0,04 г на килограмм веса человека, 0,16 г и 0,28 г на килограмм, т. е. примерно 3, 12 и 21 грамм аргинина соответственно для человека весом 75 кг. Наиболее эффективной оказалась средняя дозировка; самая большая дозировка приводила к поносу и самой низклй реакции гормона роста.

Аргинин и средечно-сосудистая система.

2 - 3 грамма аргинина в день способствуют уменьшению напряженности гладкой мускулатуры артерий, снижается диастолическая нижняя составляющая кровяного давления. Это свойство связано непосредственно с оксидом азота, именно он, получаясь из аргинина, расслабляет мускулатуру.

Аргинин улучшает реологические свойства крови, препятствует образованию кровяных сгустков и адгезии этих сгустков на внутренней стенке артерий, уменьшая риск возникновения тромбов и атеросклеротических бляшек.

Аминокислота аргинин уменьшает уровень ЛНП-холестерина, не уменьшая уровень ЛВП-холестерина. Способствует здоровой коронарной микроциркуляции, препятствует образованию сгустков крови.

Влияние на половую функцию.

Аргинин улучшает сексуальную функцию у мужчин. В результате эксперимента в Нью-Йоркском университете шесть из пятнадцати мужчин, принимавших по 2,8 грамма аргинина в день в течение двух недель, улучшили свою сексуальную функцию, в частности эрекцию, а среди мужчин, принимавших плацебо, таких не оказалось.

Надо отметить, что широко известное лекарство от импотнеции "Виагра" является бустером оксида азота.

Участие аргинина в обмене веществ.

Аргинин участвует в цикле переаминирования и выведения из организма конечного азота, то есть продукта распада отработанных белков. От мощности работы цикла (орнитин — цитруллин — аргинин) зависит способность организма создавать мочевину и очищаться от белковых шлаков.

Способность аминокислоты аргинин влиять на гормон роста отражается на всем обмене веществ организма: стимулирует рост и обновление, повышет синтез белков, влияет на жировой и углеводный обмены.

Наряду с глицином, аргинин является одним из главных ингредиентов, из которых в печени вырабатывается креатин.

Имунная система организма.

В организме человека присутствуют т.н. макрофаги - белые кровяные тельца, которые участвуют в защите организма от бактерий.

В результате исследований было обнаружено, что активность макрофагов связана с накоплением нитритов и нитратов во внеклеточной среде и установлено, что одним из орудий макрофагов служит оксид азота. Большое количество оксида азота может убивать бактерии. Дефицит оксида азота приводит к ослаблению иммунитета.

Лучшие аминокислоты для роста волос

Вот странная вещь, которую я заметила в людях – они будут использовать  на своих волосах  масло, маски для волос, шампунь и кондиционер, которые они могут захватить из аптеки или своей кухни, чтобы получить длинные, блестящие волосы. Но единственное на что они не обращают никакого внимания, – это их диета. Большинство из нас не понимают, что хорошая диета играет такую же важную роль, как и хороший уход за волосами, когда речь заходит о росте волос. И один из видов питательных веществ, которые нам нужны для поддержания здоровья наших волос и ускорения их роста, – это аминокислоты. Читайте дальше, чтобы узнать, как работают аминокислоты для роста волос.

Что такое аминокислоты?

Что такое аминокислоты, спросите вы? Аминокислоты-это органические соединения, которые состоят из аминов, карбоновой кислоты и боковой цепи, специфичной для каждой аминокислоты. Проще говоря, они являются строительными блоками белка, который составляет 1/5 часть человеческого тела. Поэтому неудивительно, что аминокислоты играют существенную роль во всех наших биологических процессах, одним из которых является рост волос.

Как аминокислоты улучшают рост волос?

Чтобы понять, как аминокислоты улучшают рост волос, мы должны сначала понять состав самих волос. Примерно 88% волос состоит из белка кератина. Чтобы наш организм вырабатывал кератин, ему требуется 18 различных типов аминокислот. В то время как некоторые из них вырабатываются нашим организмом, другие должны быть дополнены нашим рационом. Достаточный уровень этих аминокислот в нашем организме приводит к оптимальной выработке кератина, который, в свою очередь, стимулирует рост волос. Кроме того, аминокислоты играют важную роль в производстве красных кровяных телец, которые снабжают питательными веществами и кислородом волосяные фолликулы, тем самым способствуя росту волос.

Теперь вы должно быть задаетесь вопросом какие именно аминокислоты вам нужно добавить в свой рацион, чтобы ускорить рост волос. Итак, без дальнейших прощаний, давайте сразу же перейдем к делу!

Лучшие аминокислоты  для роста волос

Хотя существует около 20 различных типов аминокислот, которые играют важную роль в здоровом функционировании вашего организма, вот ТОП-9, которые необходимы для роста волос.

1. Цистеин

Цистеин, бесспорно, является наиболее важной аминокислотой для роста волос. Он не только способствует здоровому росту волос, но и помогает стимулировать рост новых волос. Цистеин является мощным антиоксидантом, который защищает волосы от солнечных лучей и других вредных излучений. Кроме того, было обнаружено, что он также лечит симптомы облысения. И он также обеспечивает серу для волосяных клеток, чтобы улучшить их текстуру и силу.

  • Основные пищевые источники цистеина включают брокколи, курицу, зародыши пшеницы, брюссельскую капусту и некоторые молочные продукты, такие как молоко и йогурт.

2. Метионин

Метионин-еще одна незаменимая аминокислота для роста волос. Эта аминокислота является сильным антиоксидантом и складом серы, ключевым ингредиентом для борьбы с расстройствами волос. Метионин является хорошим липотропным средством, поскольку он помогает расщеплять жир и предотвращает накопление жира в артериях и определенных областях тела. Эта функция метионина увеличивает кровоснабжение волосяных фолликулов и кожи головы, что в дальнейшем приводит к росту волос. Эта аминокислота также играет важную роль в синтезе коллагена, который отвечает за укрепление волосяного стержня.

  • Лучшие источники метионина: рыба, яйца, бразильские орехи, зерновые злаки и семена кунжута являются хорошими источниками метионина.

3. Лизин

Лизин помогает в образовании коллагена, поглощая кальций. Этот коллаген, как вы уже знаете, необходим для формирования основной структуры волосяных фолликулов, укрепления волосяных стержней и ускорения роста волос в целом. Лизин также останавливает 5-альфа-редуктазу от преобразования тестостерона в ДГТ, что является основной причиной андрогенной алопеции (облысение мужского типа).

  • Лучшие источники лизина: курица, яйца, рыба, красное мясо, бобовые, орехи, бобовые, красное мясо, свинина и молочные продукты являются отличными источниками лизина.

4. Глицин

Это еще одна аминокислота, которая играет важную роль в производстве коллагена, необходимого для роста волос. Глицин также играет важную роль в эффективном функционировании пищеварительной системы и центральной нервной системы. Это означает, что он защищает организм от нервных расстройств, которые могут привести к выпадению волос.

  • Лучшие источники глицина: ваш организм естественным образом вырабатывает глицин, но он также может быть дополнен такими продуктами, как мясо, молочные продукты, рыба, шпинат, бобы, капуста, соевые бобы и бананы.

5. Аргинин

Влияние аргинина на рост волос феноменально. Являясь предшественником оксида азота, эта аминокислота жизненно важна для здорового роста волос. Аргинин регулирует уровень оксида азота в нашем организме, который затем стимулирует калиевое открытие клеток. Это приводит к увеличению притока крови к корневым волосам, тем самым способствуя росту волос. Аргинин также известен тем, что повышает активность иммунной системы для защиты от аутоиммунных заболеваний, которые могут иметь радикальное влияние на ваши волосы, например андрогенной алопеции. Кроме того, он также защищает ваши волосы от вредного воздействия отбеливания и окрашивания.

  • Лучшие источники аргинина: хотя аргинин синтезируется адекватно в организме, его дефицит можно компенсировать, введя в свой рацион кешью, фундук, кокосовый орех, семена подсолнечника и кунжута, рыбу и зародыши пшеницы.

6. Цистин

Не путайте этот цистин с цистеином, о котором мы говорили ранее. Цистин-это незаменимая аминокислота, которая, как было доказано, стимулирует рост волос и борется с их выпадением. Почти десять-четырнадцать процентов нашей кожи и волос состоит из этой аминокислоты. Цистин в нашем организме образуется в результате дисульфидной связи двух молекул цистеина. Это двойное связывание аминокислот в цистине обеспечивает прочность волосяных стержней. Кроме того, эта аминокислота, как известно, также улучшает иммунитет нашего организма для борьбы с любым видом инфекции.

  • Лучшие источники цистина: поскольку цистин создается из цистеина, пищевые источники остаются теми же.

7. Тирозин

Тирозин-это незаменимая аминокислота, которая вырабатывается в нашем организме естественным путем и отвечает за окраску волос и кожи. Это происходит потому, что он помогает в производстве меланина. Известно также, что он лечит беспокойство, депрессию, бессонницу и другие связанные со стрессом проблемы, которые могут вызвать выпадение волос и препятствовать здоровому росту волос.

  • Лучшие источники тирозина: молочные и соевые продукты, миндаль, лимская фасоль, тыквенные семечки и рыба – вот несколько источников пищи, богатых тирозином.

8. Глютамин

Роль глютамина в росте волос весьма существенна. Давайте я вам объясню – основным компонентом волос является кератин, который содержит большое количество цистеина. Синтез цистеина требует большого количества серы. Эта сера доставляется в кожу головы с помощью глютамина.

  • Лучшие источники глутамина: мясо, такое как говядина, свинина и курица, молочные продукты, яйца, бобы, бобовые, орехи, капуста и шпинат являются отличными источниками глутамина.

9. Пролин

Пролин-это довольно несущественная аминокислота, которая помогает в производстве коллагена и играет важную роль в поддержании мышечных тканей.

Некоторые отличные источники пролина включают яйца, мясо, молочные продукты, бобы, соевые бобы, бобовые, шпинат, брокколи, спаржу и авокадо.

Теперь вы знаете, как аминокислоты для роста волос работают. Возможно , вы питаетесь здоровой и сбалансированной пищей, но включение в свой ежедневный рацион продуктов, богатых аминокислотами, может помочь не только ускорить рост и здоровье ваших волос, но и улучшить общее самочувствие. Это лучшая аминокислотная добавка для лечения выпадения волос.

Помогает  ли лизин в  росте волос?

Да, лизин хорош для роста волос, так как он помогает в производстве коллагена, который необходим для этого процесса.

Является ли кератин аминокислотой?

Нет, кератин-это белок.

Сколько аминокислот содержится в кератине?

В кератине содержится 18 аминокислот.

Агромастер - Аминокислоты в листовых подкормках

Хорошкин А.Б. кандидат с-х наук, ведущий специалист ГК «АгроМастер» 

Активное изучение действия подкормок аминокислотами на растения началось в 80-е годы прошлого века. Многие ученые отмечали, что аминокислоты активируют механизмы роста после соляного стресса и низких температур [1, 2, 3], повышают фертильность пыльцы и образование завязи плодов [4], повышают способность усвоения элементов питания [5] и устойчивость к вредителям и болезням [6] и т.д. 

Было открыто, что растения и животные быстрее и лучше усваивают натуральные α-аминокислоты (из которых строятся белки) оптически активной L-конфигурации. L-α-аминокислоты легко усваиваются растениями и быстро включаются в метаболизм как собственные. «D-формы аминокислот встречаются в природе сравнительно редко» [7], «как продукты метаболизма низших организмов» [8]. 

В настоящее время эффект от проведения подкормок растений L-α-аминокислотами, благодаря современным методам анализа, достаточно хорошо изучен. Если свести воедино все известные данные, то получается следующая картина: 

Действие свободных протеиногенных α-аминокислот на растения  

L-Leucine (Лейцин) и L-Isoleucine (Изолейцин)   

Повышает устойчивость к засолению (солевому стрессу) 

Улучшает прорастание пыльцы 

L-Tyrosine (Тирозин) 

Повышает устойчивость к суховеям и засухе 

Улучшает прорастание пыльцы 

L-Aspartic Acid (Аспарагиновая кислота): 

Активизирует прорастание семян 

Участвует в метаболизме аминокислот 

Источник органического азота 

L-Glutamic Acid (Глютаминовая кислота): 

Хорошие свойства хелатора  

Стимулятор роста  

Активизирует прорастание семян  

Способствует открытию устьиц  

Улучшает опыляемость 

Предшественник хлорофилла 

Предшественник аминокислот 

Активатор механизмов устойчивости к патогенам 

L-Arginine (Аргинин): 

Повышает холодостойкость 

Стимулирует синтез гормонов связанных с цветением и плодоношением 

Усиливает развитие корней 

Предшественник полиаминов 

Повышает устойчивость к засолению 

L-Phenylaninine (Фенилаланин): 

Активизирует прорастание семян 

Предшественник лигнина 

α-Glycine (Глицин) (оптически неактивен): 

Хорошие свойства хелатора 

Способствует росту тканей 

Улучшает вкус плодов 

Предшественник пиррола (C4H5N) – ядро Пиррола составная часть хлорофилла, витамина В12, цитохромов и других биологически активных соединений. 

L-Histidine (Гистидин): 

Хорошие свойства хелатора  

Улучшает созревание плодов 

Регулирует открытие устьиц 

L-Alanine (Аланин): 

Повышает холодостойкость 

Стимулирует синтез хлорофилла  

Улучшает качество плодов 

Регулирует открытие устьиц 

Повышает устойчивость к суховеям и засухе 

L-Lysine (Лизин):  

Хорошие свойства хелатора  

Стимуляция синтеза хлорофилла 

Активизирует прорастание семян  

Улучшает процессы опыления и оплодотворения 

Повышает устойчивость к суховеям и засухе 

L-Methionine (Метионин): 

Активизирует прорастание семян 

Стимулирует производство этилена  

Улучшает процессы опыления и оплодотворения  

Предшественник факторов роста 

Усиливает рост корней 

Регулирует открытие устьиц 

L-Proline (Пролин): 

Антистрессовое действие 

Повышает сопротивляемость осмотическим стрессам, регулирует водный обмен в растении 

Способствует открытию устьиц 

Повышает содержание хлорофилла и фотосинтетическую способность 

Улучшает генеративное развитие растений 

Повышает фертильность пыльцы и завязывание плодов 

Улучшает вкус плодов  

Усиливает способность семян к прорастанию 

L-Serine (Серин): 

Предшественник ауксина 

Повышает сопротивляемость стрессовым воздействиям 

Улучшает опыление и оплодотворение 

Образование гумусовых составов 

L-Threonine (Треонин): 

Активизирует прорастание семян 

Регулирует механизм защиты во время стресса 

Усиливает процесс гумификации 

L-Tryptophan (Триптофан): 

Предшественник ауксина 

Стимулирует рост меристемных тканей 

L-Valine (Валин): 

Предшественник ауксина 

Улучшает качество плодов 

Повышает устойчивость к суховеям и засухе 

Улучшает формирование семян 

L-Cysteine (Цистеин): 

Хорошие свойства хелатора 

Антиокислительная активность 

Важный компонент баланса клеточных функций 

Первые, зарегистрированные в России агрохимикаты содержащие аминокислоты: антистрессанты, стимуляторы гармоничного развития и корнеобразования появились в России в 2004 году. Этот год характеризовался затяжной, холодной весной, поэтому результаты применения этих агрохимикатов на с/х культурах были заметны визуально.  

В сезоне 2005-2006 г.г. в результате резкого падения температуры до минус 35°С в середине января, на Северном Кавказе фиксировали большой процент вымерзания озимых культур, гибель виноградной лозы и плодовых почек косточковых культур. Семечковые сады входили в весну в состоянии глубокого ступора. Было отмечено, что применение аминокислотных агрохимикатов типа Максифол Рутфарм для обработки семян способствовало сохранению озимых культур, а на семечковых садах весенняя антистрессовая программа позволила получить полноценный урожай плодов. 

В 2006 году, в ЗАО АФ «Солнечная» (г. Краснодар) на промышленных томатах в открытом грунте с использованием систем капельного полива был заложен опыт на двух (расположенных рядом) участках по 3 га. На контроле применялась разработанная в хозяйстве бюджетная схема питания простыми водорастворимыми удобрениями. На опытном участке к этой базовой (фоновой) схеме, в «каплю»  добавлялись стимуляторы гармоничного развития и корнеобразования, а на площади 0,5 га в период вегетации проводилась коррекция питания с помощью листовых подкормок. Антистрессант типа Максифол Динамикс в течение вегетации вносился 6 раз в сочетании с другими специальными агрохимикатами, в дозе 1,0 л/га. С 7.08.06 г. по 18.09.06 г. на опытном и контрольном участках производилась комиссионная учетная уборка томатов. 

Урожайность томатов Перфект Пим за период с 07.08.06 г по 18.09.06 г. на опытном и контрольном участках (ЗАО АФ «Солнечная», 2006 г.) 

Учетная площадь участка, га 

Урожайность, 

Контроль (схема фертигации хозяйства – Фон

Фон + МФ Рутфарм*, А и В - фертигация 

Фон + МФ Рутфарм*, А и В - фертигация + листовые подкормки + Максифол Динамикс*  

* - применялись аналогичные по составу агрохимикаты других торговых марок. 

Проведенный опыт наглядно продемонстрировал эффективность корневых и некорневых подкормок специальными агрохимикатами, которые включают в состав аминокислоты. Это способствовало быстрому распространению по стране практики применения данных удобрений на всех с/х культурах. 

В настоящее время в России зарегистрировано множество агрохимикатов содержащих аминокислоты. Их сопровождает большое количество рекламной информации, но некоторые термины могут иметь двоякое или широкое толкование, что требует дополнительных разъяснений.  

Так, термин «свободные аминокислоты» (САК) применим как к белковым, так и небелковым аминокислотам. Белковые (протеиногенные) аминокислоты могут находиться в растительном организме в несвязанной в белки или пептиды форме. Количество белковых САК достаточно высоко в молодых растениях (или органах) и с возрастом понижается. В вегетативных органах растений свободных аминокислот больше, чем в репродуктивных. Увеличение общего количества САК наблюдается при пониженном питании растений калием, фосфором, серой, кальцием и магнием. Такое же действие происходит при недостатке ряда микроэлементов: цинка, меди, марганца, железа. Это связано с ослаблением синтеза белков из аминокислот в этих условиях.  

По поводу непротеиногенных аминокислот доктор биологических наук Чекалин Н.М. в своей монографии «Генетические основы селекции зернобобовых культур на устойчивость к патогенам» (Полтава, 2003) писал: «Свободные (небелковые) аминокислоты (900 структур), структурно аналогичные белковым аминокислотам, в изобилии содержатся у некоторых бобовых (Vicieae, Phaseoleae, Mimosoideae), являются токсичными и выполняют функцию азот-запасающего компонента. Свободные аминокислоты (САК) могут: принимать участие в биосинтезе рибосомального белка, приводя к образованию дефектного белка; ингибировать синтез аминоацил-tРНК-синтетазы или другие пути биосинтеза белка. Свободные аминокислоты вызывают у растений, микроорганизмов и насекомых уменьшение роста и даже гибель; у позвоночных - эмбриональное уродство, нейротоксичные нарушения, паралич, цирроз печени, аритмию и др.» «Многие (небелковые САК – А.Х.) аминокислоты, образовавшиеся при обмене веществ низших организмов, имеют свойства антибиотиков. Они действуют как аминокислоты – антагонисты, т.е. являются конкурентными ингибиторами при обмене веществ, задерживая определенные ступени биосинтеза аминокислот или способствуя образованию ложных последовательностей при биосинтезе белков» [9]. 

 Исходя из вышеизложенного, применение в описании агрохимикатов термина «свободные аминокислоты», как однозначно более эффективного материала, требует определенной конкретизации. 

«В настоящее время описано около 300 аминокислот, найденных в природе. Однако только 20 аминокислот входят в состав белков» [10], т.е. называются протеиногенными. Ещё их называют незаменимыми, т.к. они продуцируются только растительными организмами, но «являются основными составными частями животных и растительных белков, причем их встраивание в молекулу белка регулируется информацией генетического кода» [11]. 

С 2015 года, в рамках импортозамещения, в России появились специальные высокотехнологичные агрохимикаты  собственного производства «Аминофол» и «Максифол», одним из основных компонентов которых являются свободные протеиногенные L-α-аминокислоты в концентрации более 10%. Это важно, т.к. весь опыт ведущих мировых производителей показал, что более низкая концентрация аминокислот в агрохимикате  существенно снижает их эффективность. 

Линия отдельных мезо- и микроэлементов Аминофол (Mg, Fe, Mn, Zn, Cu и Mo) базируется на свойстве аминокислот образовывать комплексные соединения с металлами по типу хелатизации. Эти «аминокислотные комплексы металлов имеют октаэдрическое строение, причем два остатка аминокислоты связаны с центральным атомом металла амино- и карбоксильными группами, а свободные координационные связи заняты водой. Особой устойчивостью отличаются комплексы с аминокислотами, имеющими функциональные боковые цепи, как например, гистидин, азот имидазола в котором образует дополнительную (третью) связь с центральным атомом» [12].  

В силу того, что в самом растении «в реакциях комплексообразования с микроэлементами принимают участие различные органические соединения содержащиеся в них: аминокислоты, пептиды, белки» [13] и т.п., комплексы Аминофол не являются чужеродными и полностью усваиваются растением. Высокую степень усвоения элементов питания без риска фитотоксичности обеспечивают: Глютаминовая кислота; Цистеин; Глицин; Гистидин и Лизин, которые образуют хелатные соединения с микроэлементами, а Тирозин, Аргинин, Аланин, Пролин, Серин, Треонин и Валин стимулируют метаболизм, и способствуют лучшему усвоению питательных веществ даже в стрессовых ситуациях. Линия Аминофол обеспечивает эффективное лечение хлорозов при возникновении дефицита, а при своевременном применении отлично удовлетворяет индивидуальные потребности с/х культур в мезо- и микроэлементах.  

Аминофол Плюс – специальный антистрессовый агрохимикат с высоким (59%) содержанием свободных протеиногенных аминокислот, применение которого помогает растениям преодолевать стрессовые ситуации, стимулирует метаболизм и усвоение питательных веществ, что существенно повышает урожайность и качество продукции даже в неблагоприятных условиях. 

Аминофол NPK – специальный агрохимикат содержащий макроэлементы N-5, P-15, K-10 и 32% аминокислот. Применение Аминофол NPK помогает преодолевать не только стрессовые ситуации, стимулируя метаболизм, рост и развитие растений, но и повышает устойчивость к заболеваниям, т.к. фосфор и калий в нем находятся в форме фосфита калия, который запускает функцию эндогенной защиты растения, стимулируя синтез фитоалексинов – антибиотиков продуцируемых самим растением. 

Агрохимикаты «Максифол Рутфарм» - стимулятор корнеобразования и антистрессант «Максифол Динамикс», кроме специфических аминокислот содержат концентрированный экстракт морских водорослей Ascophyllum nodosum, который богат биологически активными веществами,  антиоксидантами, альгиновой кислотой и фитогормонами: цитокинином, ауксином, гиббереллином и глицинбетаином. Эти активные компоненты усиливают устойчивость растений к стрессам различной этиологии, и способствуют повышению количественных и качественных параметров урожайности.  

Библиографический список: 

  1. Mladenova Y.I., Rotcheva S., Vinarova K. 1989. Changes of growth and metabolism of maize seedlings under NaCl stress and interfering effect of Siapton leaf organic fertilizer on the stress responses. In: 20th Ann. ESNA Meeting, Lunteren (NL), Oct. (poster). 
  2. Soro R. 1985. Recuperacion de los citricos afectados por las heladas. Valencia-fruits, Febr.:9 
  3. Soro R. 1985. Estimulacion de naranjos. Agricola Vergel, 4: 166-169. 
  4. Marcucci M.C. 1984. The influence of storage and of organic nutrients on the germination of pollen and fruit set of apple and pear. Acta Hort., 149: 117-122 
  5. Stoyanov I. 1981. Restoration of maize plants after Magnesium starvation with the help of Magnesium and Siapton. Proc. 3rd Int. Symp. Plant Growth Regulators, Varna, Bulgaria, (B.A.S., Sofia, ed, publ. 1985) pp. 602-606 
  6. Kovacs A.I., Maini P., De Leonardis A. 1986. Effetto nematostatico del biostimolante Siapton. Atti Giornate Fitopatol., Riva del Garda, CLUEB Ed. BO, pp. 415-424 
  7. В.Л. Кретович, Биохимия растений. М. «Высшая школа», 1986, стр. 27 
  8. Х.-Д. Якубке, Х. Ешкайт, Аминокислоты Пептиды Белки. М. «Мир»,1985, стр.9 
  9. Х.-Д. Якубке, Х. Ешкайт, Аминокислоты Пептиды Белки. М. «Мир» 1985, стр.20 
  10. В.Л. Кретович, Биохимия растений. М. «Высшая школа», 1986, стр. 25 
  11. Х.-Д. Якубке, Х. Ешкайт, Аминокислоты Пептиды Белки. М. «Мир», 1985, стр.17 
  12. Х.-Д. Якубке, Х. Ешкайт, Аминокислоты Пептиды Белки. М. «Мир», 1985, стр.67  
  13. Н.П. Битюцкий, «Микроэлементы и растение», Изд. С-ПбУ, 1999, стр. 156 

Питательные и структурные элементы, необходимые для нормального роста волос.

Питательные и структурные компоненты необходимые для роста волос.

Аминокислоты.

Из 20 аминокислот, существующих в природе, в кератине представлены 18, значительную часть которых составляют серосодержащие аминокислоты (цистеин и метионин). В состав белков человека входят 2 аминокислоты, содержащие серу, — метионин и цистеин. Эти аминокислоты метаболически тесно связаны между собой. Цистеин и метионин необходимы для синтеза кератина – основного белка волосяного стержня.

Метионин

Метионин — незаменимая аминокислота, то есть не синтезируется в организме человека. Поэтому метионин должен постоянно поступать в организм вместе с пищей. Метионин – «стартовая» аминокислота при синтезе всех без исключения белков на рибосомах – является основным фактором, обеспечивающим нормальный запуск процессов белкового синтеза. L  – метионин основной донор биодоступной серы, поставляет SH-группы, необходимые для синтеза кератина – основного белка волосяного стержня, глутатиона, карнитина, фосфолипидов и других важнейших веществ. Метионин является источником серы при биосинтезе цистеина, который также участвует в синтезе кератина.

Основные натуральные источники 
Больше всего встречается в говяжьем и курином мясе, в говяжей печени и треске, достаточно много содержится в твороге, куриных яйцах; крупах (по убыванию) рисовой, пшенной, овсяной, гречневой, перловой, пшеничной, манной; в горохе, макаронах и уже меньше в молоке/кефире и хлебе.

Входит в состав следующих препаратов:
АльфаУно, АльфаУно Плюс, Триковэл, Биорекс, Веда Пауэр, Иммуджен.

Цистеин

Входит в состав α-кератинов, основного белка ногтей, кожи и волос. Он способствует формированию коллагена, улучшает эластичность и текстуру кожи, ускоряет регенерацию кожи после операций, ожогов.. Цистеин входит в состав и других белков организма, в том числе некоторых пищеварительных ферментов.

Цистеин — заменимая аминокислота, которая может синтезироваться в организме из серина с участием метионина как источника серы, а также АТФ и витамина В6. Способствует обезвреживанию некоторых токсических веществ и защищает организм от повреждающего действия радиации. Один из самых мощных антиоксидантов, при этом его антиоксидантное действие усиливается при одновременном приеме витамина С и селена или в сочетании с витамином Е. Цистеин является предшественником глутатиона — вещества, оказывающего защитное действие на клетки.

Природные источники цистеина: Содержится в продуктах питания с высоким уровнем белка, в том числе: соя, мясо, птица, яйца, горох, овес, кукуруза, семечки, подсолнечника, мука пшеницы, грецкие орехи, бобы, фасоль, чечевица. Так же, некоторое количество цистеина содержится в красном перце, чесноке, луке, брюссельской капусте, брокколи.

Входит в состав следующих препаратов:
АльфаУно, АльфаУно Плюс, Триковэл, Биорекс, Веда Пауэр

L-Аргинин 

L-Аргинин – субстрат для ферментов, называемых NO-синтазами, работа которых приводит к образованию оксида азота (NO). NO является мощным сосудорасширяющим фактором, регулирующим поступление крови в органы и ткани тела, в том числе к волосяным луковицам. Таким образом, l-аргинин улучшает микроциркуляцию, а следовательно, доставку питательных и структурных компонентов, необходимых для роста волос.

Аргинин необходим для синтеза гормонов (например, гормона роста) и процессов азотистого обмена. От мощности работы цикла (орнитин – цитруллин – аргинин) зависит способность организма создавать мочевину и очищаться от белковых шлаков.

Аргинин способен увеличивать мышечную и уменьшать жировую массу тела, в конечном результате делая фигуру более стройной.
Аргинин обладает выраженным психотропным эффектом. Вызывая увеличение количества соматотропного гормона (СТГ) до верхних нормальных границ, аргинин способствует улучшению настроения, делает человека более активным, инициативным и выносливым, улучшает половую функцию.

Природные источники аргинина: Орехи, мясо, рыба, соя, пшеница, рис, овес.

Входит в состав следующих препаратов: 
Биорекс, Биорекс-Нони, Триковэл, НеоКрилоидин

Витамины.

Витамин C (Аскорбиновая кислота).

Витамин С — мощный антиоксидант. Он играет важную роль в регуляции окислительно-восстановительных процессов, участвует в синтезе коллагена и проколлагена, обмене фолиевой кислоты и железа, а также синтезе стероидных гормонов и катехоламинов. Аскорбиновая кислота также регулирует свертываемость крови, нормализует проницаемость капилляров, необходима для кроветворения, оказывает противовоспалительное и потивоаллергическое действие.Витамин С важен для роста и восстановления клеток, в том числе клеток волосяного фолликула и кровеносных сосудов.

В присутствии адекватного количества витамина С значительно увеличивается устойчивость витаминов В1, В2, A, E, пантотеновой и фолиевой кислот, необходимых для нормального функционирования волосяного фолликула и роста волос.  Витамин С предохраняет холестерин липопротеидов низкой плотности от окисления и, соответственно, стенки сосудов от отложения окисленных форм холестерина.
Наш организм не может запасать витамин С, поэтому необходимо постоянно получать его дополнительно. Поскольку он водорастворим и подвержен действию температуры, приготовление пищи с термической обработкой его разрушает.

Основные природные источники: цитрусовые, овощи листовые зеленые, дыня, брокколи, брюссельская капуста, цветная и кочанная капуста, черная смородина, болгарский перец, земляника, помидоры, яблоки, абрикосы, персики, хурма, облепиха, шиповник, рябина, печеный картофель в "мундире". Травы, богатые витамином С: люцерна, коровяк, корень лопуха, песчанка, очанка, семя фенхеля, пажитник сенной, хмель, хвощ, ламинария, мята перечная, крапива, овес, кайенский перец, красный перец, петрушка, сосновые иглы, тысячелистник, подорожник, лист малины, красный клевер, плоды шиповника, шлемник, листья фиалки, щавель.

В продуктах животного происхождения — представлена незначительно (печень, надпочечники, почки).

Входит в состав следующих препаратов:
Биорекс, Триковэл

Основные антагонисты: ряд химических соединений, действию которых подвергается человек, такие, как загрязнители воздуха, промышленные токсины, тяжелые металлы, табачный дым, а также некоторые фармакологически активные соединения, в частности, антидепрессанты и диуретики могут привести к увеличению потребности в витамине С.

Тиами́н (витамин B1) 

Для нормального роста  волос необходимы витамины группы B, которые оказывают как самостоятельное действие на рост и состояние волос, а также являются своеобразным катализатором, ускоряющим действие других веществ. В1 — водорастворимый витамин. Тиамин играет важную роль в процессах метаболизма углеводов и жиров. Вещество необходимо для нормального протекания процессов роста и развития и помогает поддерживать надлежащую работу сердца, нервной и пищеварительной систем. Тиамин, являясь водорастворимым соединением, не запасается в организме и не обладает токсическими свойствами.

Как правило, развитие дефицита тиамина бывает связано с нарушениями в питании. Это может быть как следствием недостаточного поступления тиамина с пищей, так и происходить в результате избыточного употреблением продуктов, содержащих значительные количества антитиаминовых факторов. Так, свежие рыба и морепродукты содержат значительные количества тиаминазы, разрушающей витамин; чай и кофе ингибируют всасывание тиамина.

Основные природные источники. Основные количества тиамина человек получает с растительной пищей. Богаты тиамином такие растительные продукты, как пшеничный хлеб из муки грубого помола, соя, фасоль, горох, шпинат. Меньше содержание тиамина в картофеле, моркови, капусте. Из животных продуктов содержанием тиамина выделяются печень, почки, мозг, свинина, говядина. Также в дрожжах, Витамин B1 также синтезируется некоторыми видами бактерий, составляющих микрофлору толстого кишечника.

Входит в состав следующих препаратов:
Биорекс, Триковэл

Рибофлави́н (лактофлавин, витамин B2) 

Один из наиболее важных водорастворимых витаминов, кофермент многих биохимических 
процессов. Витамин B2 необходим для образования эритроцитов, антител, для регуляции роста и репродуктивных функций в организме. Он также необходим для здоровой кожи, ногтей, роста волос и для здоровья всего организма в целом.

Внешними проявлениями недостаточности рибофлавина у человека являются поражения слизистой оболочки губ, изъязвления в углах рта, отёк и покраснение языка, себорейный дерматит. Часто развиваются также изменения со стороны органов зрения.

Основные причины недостатка рибофлавина у человека — недостаточное потребление продуктов содержащих этот витамин; неправильное хранение и приготовление продуктов содержащих данный витамин, вследствие чего содержание витамина резко уменьшается; хронические заболевания желудочно-кишечного тракта, приём медикаментов, являющихся антагонистами рибофлавина.

Основные природные источники. Рибофлавин содержится в печени, почках, дрожжах, миндале, твороге.

Человеческий организм не накапливает рибофлавин, и любой избыток выводится вместе с мочой.

Входит в состав следующих препаратов:
Биорекс, Триковэл

Витамин РР (Витамин В3, ниацинамид, никотинамид, никотиновая кислота)

Снабжает энергией растущие структуры, усиливает циркуляцию крови, способствуя лучшему питанию волос, улучшает снабжение волосяных фолликулов кислородом, входит в состав коэнзимов, участвующих в процессах клеточного обновления, стимулирует рост волос, выполняет функции увлажняющего агента. Он участвует в первом этапе окислительно-восстановительных процессов — образовании АТФ — источника энергии. В результате волосы получают больше питательных веществ и быстрее растут. Он отвечает за образование пигментов в волосах.  При его недостатке нарушается рост волос, и они начинают рано седеть.

Основные природные источники. 
Источниками ниацина являются продукты животного происхождения: мясо, печень, почки и сердце домашних животных, рыба, яйца, сыр, а также растительного — картофель, зеленый горошек, томаты, перец красный сладкий, капуста, крупы (особенно гречневая), бобовые, арахис, цельное зерно и пивные дрожжи. Никотинамид может синтезироваться из триптофана, поступающего с пищей, а также бактериями кишечника.

Входит в состав следующих препаратов:
АльфаУно, АльфаУно Плюс

Пантотенат кальция (витамин В5):

Пантенол и пантотенат кальция регулируют обмен веществ в коже, оказывают противовоспалительное действие, способствуя устранению дефектов кожи и волос. Они улучшают кровообращение в коже, обеспечивают увлажняющий эффект. Усиливает доставку кислорода и  укрепляет волосяную луковицу.

Входит в состав следующих препаратов: 
Триковэл

Витамин В6 (пиридоксина хлоргидрат, пиридоксин):

Термин витамин В6 или пиридоксин используется для обозначения целой группы родственных веществ, взаимозаменяемых в процессе метаболизма, а именно: пиридоксол (спирт) , пиридоксаль (альдегид) и пиридоксамин (амин).

Улучшает работу сосудов. Предотвращает появление зуда, сухости головы и, как следствие, препятствует образованию перхоти. При недостатке витамина В6 волосы могут стать тусклыми, начать выпадать, также может возникнуть себорея.

Основные природные источники
В пищевых продуктах витамин В6 обычно связан с белками. Пиридоксол обнаруживается главным образом в растениях, а пиридоксаль и пиридоксамин главным образом обнаруживаются в животных тканях. Превосходными источниками пиридоксина являются цыплята, коровья печень, свинина и телятина. Хорошими источниками пиридоксина также являются ветчина и рыба (тунец, форель, палтус, сельдь, лосось) , орехи (арахис, грецкий орех) , хлеб, крупа и цельные зерна злаковых. В целом овощи и фрукты достаточно бедны витамином В6, хотя некоторые из продуктов этого класса содержат пиридоксин в весьма значительном количестве, в частности фасоль, цветная капуста, бананы и изюм.

Несмотря на то, что витамин В6 синтезируется кишечными бактериями,человек для удовлетворения потребностей своего организма нуждается во внешних источниках витамина В6, поступающего вместе с пищей.

Входит в состав следующих препаратов: 
Триковэл

Фолиевая кислота

Обеспечивает деление клеток, в том числе клеток волосяной луковицы и рост тканей. Повышает биодоступность и утилизацию железа, присутствующего в организме, что также важно для роста волоса.

Основные природные источники:
Бобовые, салат, шпинат, капуста, зеленый лук, зеленый горошек, фасоль, соя, свекла, морковь, томаты, мука грубого помола и хлебобулочные изделия из этой муки, гречневая и овсяная крупы, пшено, дрожжи. Из продуктов животного происхождения богаты фолиевой кислотой печень, почки, творог, сыр, икра, яичный желток.

Входит в состав следующих препаратов:
Триковэл

Витамин Е

Под названием витамин Е известны восемь встречающихся в природе соединений. Альфа-токоферол — наиболее распространенный и биологически наиболее активный из всех встречающихся в природе форм витамина Е.

Витамин Е – основной ингибитор перекисного окисления липидов. Это жирорастворимый антиоксидант. Он содержится в липидной части клеточной мембраны и защищает её от процессов липопероксидации, запускаемых свободными радикалами.

Все компоненты с антиоксидантной активностью защищают волосы от повреждающего действия свободных радикалов, сохраняют их здоровье и силу
Действие витамина Е усиливается селеном (синергичность).

Основные природные источники. Растительные масла (арахисовое, соевое, пальмовое, кукурузное, сафлоровое, подсолнечное и т. д. ) и зародыши пшеницы являются наиболее ценными источниками витамина Е. К числу других источников витамина Е относятся орехи, семена, цельные зерна и зеленые листовые овощи. Некоторые основные продукты питания типа молока и яиц содержат небольшое количество a-токоферола.

Входит в состав следующих препаратов:
АльфаУно, АльфаУно Плюс, Триковэл, Иммуджен

Основные антагонисты
При одновременном приеме железо уменьшает поступление витамина Е в организм. Потребность в витамине Е связана с количеством полиненасыщенных жирных кислот, поступающих с пищей. Чем больше количество таких кислот, тем больше потребность в витамине Е.

Биотин (Витамин Н, витамин B7, кофермент R) — водорастворимый витамин группы В.

Биотин играет важную роль в углеводном обмене, взаимодействуя с гормоном поджелудочной железы инсулином. Биотин исключительно важен для поддержания стабильного уровня сахара в крови. 
Он помогает усваивать белок и в обмене веществ является важным союзником других витаминов группы В, таких как фолиевая и пантотеновая кислоты и витамин В12. Кроме того, он участвует в метаболизме жирных кислот и в сжигании жира.

Биотин контролирует обмен жиров и преимущественно находится в клетках кожи и волос, поэтому, он влияет на содержание и состав жира в коже. Он делает кожу головы менее маслянистой, и может улучшать общую структуру и внешний вид волос. Там, где не хватает витамина, наступает себорея — нарушение функции сальных желез. Ее последствиями являются, в частности, выпадение волос и перхоть. Поскольку биотин содержит серу, он необходим для кожи, волос и ногтей. При дефиците биотина возникает и дефицит серы, кожа становится бледной, а волосы тусклыми. Более ломкими становятся и ногти. Биотин в сочетании с витаминами В-комплекса, незаменимыми жирными кислотами и такими минералами, как цинк используется при лечении себорейного дерматита.

Потребность в биотине возрастает при длительном лечении антибиотиками, которые подавляют кишечную микрофлору, продуцирующую биотин. Для превращения биотина в активную форму необходим магний, и если у вас дефицит магния, также может наступить недостаточность биотина.

Основные природные источники. 
Биотин содержится в очень многих продуктах питания. В продуктах животного происхождения его больше: в свиной и говяжьей печени и почках, сердце быка, желтках яиц. Есть он также в говядине, телятине, курином мясе и ветчине, коровьем молоке и сыре, сельди, камбале, консервированных сардинах.

Из растительных продуктов им богаты помидоры, соевые бобы, неочищенный рис и рисовые отруби, пшеничная мука, арахис, шампиньоны, зелёный горошек, морковь и цветная капуста, яблоки и апельсины, бананы и дыня, картофель, свежий лук, цельные зёрна ржи.

В тканях животных биотин связан с белками, а во фруктах и овощах он содержится в свободном состоянии. Все эти продукты могут являться для нас источником биотина, но тот биотин, который необходим нашим клеткам, синтезируется именно кишечной флорой, при условии правильного питания и хорошего здоровья, либо поступает в организм в составе некоторых препаратов.

Входит в состав следующих препаратов:
Триковэл

Микроэлементы.

Селен

Селен входит в активные центры многих ферментов. От участия селен-содержащих ферментов зависят прежде всего антиоксидантная и обеззараживающая функции организма. Этим объясняется, почему человеческий и животный организм не может выжить без минимально необходимой дозы селена.

В продуктах селен находится в виде селеносодержащих аминокислот – селенометионина и селеноцистеина. Достаточное поступление метионина – одно из основных условий для усвоения селена.

Основные природные источники.

  • Селен содержится в морской и каменной солях, в почках (свиных, говяжьих и телячьих), в печени и сердце, в яйцах птицы, к тому же в желтке еще есть и витамин Е. Богаты селеном продукты морей — рыба, особенно сельдь. Бурые водоросли также заметно аккумулируют селен из морской воды. Селена нет в обработанных продуктах — консервах и концентратах, а во всех вареных, рафинированных продуктах его наполовину меньше, чем в свежих.
  • Из продуктов растительного происхождения богаты селеном пшеничные отруби, проросшие зерна пшеницы, зерна кукурузы, помидоры, пивные дрожжи, грибы и чеснок, а также черный хлеб и другие продукты из муки грубого, помола. Высокие концентрации селена характерны для шампиньонов и дождевиков.
  • Есть ряд лекарственных растений, богатых селеном. Это водоросли спирулины, береза повислая, эвкалипт лекарственный, солодка уральская, донник лекарственный, эфедра полевая и хвощ полевой.

Почему люди, употребляющие эти продукты в большом количестве, все равно испытывают дефицит селена? Обеспечить организм селеном, только полагаясь на определенную диету, невозможно. Содержание селена в растительной пище всегда зависит от почвы, на которой растение выросло. Растениям не нужен селен для нормального роста. Они беспрепятственно растут и на почвах, не содержащих селен и в этом случае, как следствие, и сами не содержат селен.

Немного лучше обстоит дело с продуктами животного происхождения. Так как селен также необходим животным для выживания, как и людям, корм для животных содержит всегда какое-то количество селена. В корма для животных также добавляется селен для улучшения качества мяса. Таким образом через потребление мяса осуществляется определенное снабжение селеном.

Подавляющая часть морских организмов обладает способностью накапливать селен, но не в биологически доступной форме. Он образует труднорастворимые комплексы с ртутью, которые не являются токсичными, однако, затрудняют усвоение селена.

Антагонисты селена. К факторам, снижающим биодоступность Se, относятся тяжёлые металлы (Cd, Hg), мышьяк, избыток и недостаток соединений серы, дефицит витаминов. Опасный «враг» селена — углеводы. А это значит, что пирожные, сладкие пироги, торты и печенье, все сладкие мучные продукты, все газированные напитки могут значительно затруднять использование организмом селена

Входит в состав следующих препаратов:
Иммуджен,

Медь

Медь используется в процессе синтеза белков, входит в активные центры многих ферментов, а также участвует в процессах роста и развития клеток и тканей. Она необходима для нормального процесса кроветворения и работы иммунной системы.

Медь участвует в синтезе коллагена, необходимого для образования белкового каркаса скелетных костей. Людям, имеющим хрупкие кости и склонным к переломам, часто бывает достаточно ввести в рацион питания добавки с медью – и переломы прекращаются, так как перестают вымываться минералы, укрепляется костная ткань, предотвращается развитие остеопороза.

Благодаря меди наши кровеносные сосуды принимают правильную форму, долго оставаясь прочными и эластичными. Медь способствует образованию эластина – соединительной ткани, образующей внутренний слой, выполняющий функцию каркаса сосудов.

Вместе с аскорбиновой кислотой медь поддерживает иммунную систему в активном состоянии, помогая ей защищать организм от инфекций; ферменты, отвечающие за защиту организма от свободных радикалов, тоже содержат в своём составе медь.

Особенно нужна медь для поддержания структуры фермента супероксиддисмутазы, обладающего мощным антиоксидантным действием. Этот фермент играет не последнюю роль в предупреждении преждевременного старения кожи и истончения волос – отвечает за целостность клеток, поэтому он часто входит в состав самых эффективных антивозрастных косметических средств.
Упругость и эластичность кожи поддерживается с помощью коллагена – в его составе тоже есть медь.

Медь стимулирует активность гормонов гипофиза и поддерживает в норме работу эндокринной системы. Так, белки и углеводы в присутствии меди усваиваются лучше, а активность инсулина повышается. Улучшая работу желез внутренней секреции, способствуя выработке необходимых ферментов и соков, медь нормализует процесс пищеварения и защищает пищеварительную систему от повреждений и воспалений. Без меди не может нормально формироваться мозг и нервная система – медь является основным компонентом миелиновых оболочек, без которых нервные волокна не могут проводить импульсы, а потом просто разрушаются.

Чтобы удовлетворять потребность в меди, человеку достаточно просто разнообразно питаться. Взрослому человеку достаточно 2 мг меди в день, а с пищей обычно попадает в 2-3 раза больше – если питание правильное. Усваивается, как правило, только третья часть всей попадающей в организм меди, так что ни дефицита, ни переизбытка наблюдаться не должно. Дефицит крайне редок, однако сегодня нехватка меди наблюдается чаще, чем в прежние времена. Дело в том, что раньше в почву не вносили в таких количествах азотистые удобрения, образующие аммиак, способный «забирать» медь из почвы. Вегетарианство и различные диеты тоже могут уменьшать количество меди в организме.

Недостаток меди приводит к задержке роста, развитию анемии, потере веса, накоплению холестерина, атрофии сердечной мышцы, остеопорозу, кожным заболеваниям, потере волос, утомляемости и частым инфекциям. Возникает также варикозное расширение вен, кожа рано покрывается морщинами, а волосы седеют.

Основные природные источники. Много меди в орехах, сыром яичном желтке, печени, бобовых, злаках, кисломолочных продуктах, овощах, фруктах и ягодах. Медь есть в свежем мясе животных, рыбе, морепродуктах, проросшей пшенице, сое, ржаном хлебе, спарже, картофеле и травах: укропе, лапчатке прямостоячей, марене красильной, сушенице, листьях чайного куста, лобелии вздутой. Питьевая вода тоже содержит медь – примерно 1 мг на литр.

Обычно той меди, которая попадает в организм человека с продуктами питания, бывает вполне достаточно, так что нехватка меди чаще всего обусловлена природными особенностями или нарушением обменных процессов.

Учёные считают, что людям с тёмными волосами требуется больше меди, чем светловолосым, так как медь необходима для поддержания окраски волос, т.к. без меди нарушается использование аминокислоты тирозина, которая является одним из основных факторов, отвечающих за цвет кожи и волос. Нехватка меди проявляется ранней сединой, поэтому темноволосым людям следует стараться включать в рацион больше продуктов, в которых её содержится много.

Входит в состав следующих препаратов:
АльфаУно, АльфаУно Плюс, Триковэл, Биорекс

Антогонисты меди. При нехватке меди следует отказаться от употребления чёрного чая, не принимать большие дозы препаратов железа и аскорбиновой кислоты.

Цинк

Цинк играет важную роль в реализации гормональных функций в организме. Оказывает антиандрогенное действие, стимулирует рост волос.

Основные природные источники.

Входит в состав следующих препаратов:
АльфаУно, АльфаУно Плюс, Триковэл,  Биорекс

 

Источники энергии для роста волос.

Подкожная жировая клетчатка (гиподерма) представляет собой хранилище энергии и располагается под дермой.

Коэнзим Q10

Играет важную роль в процессе образования энергии, поддерживая деятельность митохондрий, что особенно важно для быстрорастущих структур, какими являются волосяные фолликулы.

Содержание АТФ в волосяной луковице.

Входит в состав следующих препаратов:
ИммудженБиорекс

Витамин РР (Витамин В3).

Снабжает энергией растущие структуры, усиливает циркуляцию крови, способствуя лучшему питанию волос, улучшает снабжение волосяных фолликулов кислородом, входит в состав коэнзимов, участвующих в процессах клеточного обновления, стимулирует рост волос, выполняет функции увлажняющего агента. Он участвует в первом этапе окислительно-восстановительных процессов — образовании АТФ — источника энергии. В результате волосы получают больше питательных веществ и быстрее растут. Он отвечает за образование пигментов в волосах.  При его недостатке нарушается рост волос, и они начинают рано седеть.

Основные природные источники. 
Источниками ниацина являются продукты животного происхождения: мясо, печень, почки и сердце домашних животных, рыба, яйца, сыр, а также растительного — картофель, зеленый горошек, томаты, перец красный сладкий, капуста, крупы (особенно гречневая), бобовые, арахис, цельное зерно и пивные дрожжи. Никотинамид может синтезироваться из триптофана, поступающего с пищей, а также бактериями кишечника.

Входит в состав следующих препаратов:
АльфаУно, АльфаУно Плюс

Аминокислоты для роста мышц: как принимать их начинающим?

Автор ВладимирВремя чтения 5 мин.Просмотры 229

Доброго времени суток, уважаемые читатели. А вы знаете, что мышечная ткань на 80 процентов состоит из воды и всего на 20 из белков? Но хлопот от этих 20-ти процентов…

Именно они должны расти после тренировки, именно от их восстановления зависит ваш успех в тренажерном зале. И конечно же им постоянно требуется подпитка. Надеюсь, вы в курсе, что наши мышцы питаются аминокислотами. Поэтому давайте разберемся насколько важны аминокислоты для роста мышц как принимать их и чем чреват недостаток данного органического соединения.

Важны ли аминокислоты для нас?

Наши мышцы состоят из белка (протеина), а он в свою очередь включает в себя множество аминокислот. Отсюда вывод таков: нет аминокислот — нет белков — нет мышц. Аминокислоты по сути являются основными строительными блоками из которых состоит все наше тело. Поэтому их роль в нашей жизни сложно переоценить.

Теперь поставим вопрос иначе. Важен ли их дополнительный прием из добавок? Чтобы ответить на него, ознакомимся с таким понятием как незаменимость.

Существует три вида аминокислот: заменимые, условно незаменимые и незаменимые.

Первые организм синтезирует сам, вторые он может синтезировать только для удовлетворения основных нужд и последние мы получаем из пищи. Как правило, большинство добавок включают в себя условно незаменимые и незаменимые аминокислоты.

Несмотря на то, что норму мы можем получить из продуктов, в условиях повышенных физических нагрузок потребность в аминокислотах увеличивается. Особенно на сушке, когда в организме преобладают катаболические процессы. Таким образом, прием аминокислотных комплексов может быть оправдан, но не всегда.

Добавки влияющие на рост мышц

По факту аминокислотные комплексы являются уловкой производителей. Что? Обман? – спросите вы. Нет, просто производители берут протеиновый порошок, раскладывают белок на аминокислоты и продают втридорога. Конечно, в таком виде ваши мышцы получат питательные вещества быстрее чем из протеина, но не всегда есть смысл переплачивать. Кстати доказано, что прием аминокислот увеличивает синтез белка в мышцах, но этот эффект не велик.

Существуют добавки более узкого состава. Например, ВСАА. Они содержат только три незаменимых аминокислоты: изолейцин, валин и лейцин. Эти компоненты наиболее важны для наших мышц. Но принимать их отдельно нет смысла. Так как они входят в состав аминокислотных комплексов и протеина.

Глютамин является излюбленной добавкой многих бодибилдеров. Это заменимая аминокислота, которая в больших количествах содержится в нашем организме. Может синтезироваться из других аминокислот.

Прием глютамина в первую очередь полезен тем, что он является источником энергии (актуально на сушке). Во-вторых, добавка повышает стойкость организма к инфекциям. А чем меньше вы болеете, тем лучше прогресс в зале. Производители на первое место ставят влияние глютамина на прирост мышечной массы. Но данный эффект не доказан.

Как принимать аминокислоты?

Для того чтобы получить пользу от приема добавок, надо знать как и когда их принимать. Иначе — просто выбросите деньги на ветер.

Как мы уже выяснили, аминокислоты нам нужны для подавления катаболических процессов (разрушение тканей) в организме и поддержания анаболических процессов (синтез тканей). Следовательно, принимать их нужно утром после пробуждения. Как раз в это время организм нуждается в быстрой подпитке после продолжительного сна.

Лучше принимать протеиновый коктейль, так как аминокислоты и ВСАА принятые на голодный желудок могут вызвать его раздражение. Загрузите в шейкер 20-25 грамм протеинового порошка и залейте водой. Что касается аминокислот, то 10-15 грамм будет достаточно.

Вторым важным периодом для их употребления является время до и после тренировки. Прием добавки перед занятиями снабдит вас дополнительной энергией. А послетренировочный прием восполнит пул аминокислот в мышцах. Аминокислоты лучше принимать отдельно от других добавок. Не принимайте добавку с гейнером или пищей, так как это снизит скорость её усвоения. Оптимальной будет порция от 10 до 15 грамм.

Для начинающих я бы советовал малые дозировки, от 5 до 10 грамм. Так как ваша мышечная масса наверняка еще невелика и не требует серьезной дополнительной подпитки.
Аминокислотные комплексы и ВСАА подходят для приема диабетиками. Потому что не содержат углеводов. А некоторые аминокислоты, например аргинин, способны положительно влиять на уровень сахара в крови.

Прием глютамина несколько отличается. Глютамин совместим с другими добавками. Наиболее оптимальным сочетанием является комбинация с креатином. Принимайте 4-8 грамм добавки после тренировки и перед сном.

Стоит отметить, что ни один из выше перечисленных продуктов спортивного питания практически не обладает побочными эффектами. Это не значит, что надо закидывать их в себя огромными порциями. Излишки будут выводиться из организма, но при этом дополнительно нагружать печень и почки. Не забудьте посмотреть видео с компетентным мнением опытных атлетов.

Заключение

Безусловно, аминокислоты важны для нашего организма. Но не всегда оправдан их дополнительный прием из спортивных добавок. Старайтесь рассчитывать необходимое количество белка индивидуально для вашего организма. И если из пищи вы не получаете норму, то можно прибегнуть к приему дополнительных добавок.

На этом я заканчиваю свое повествование. Обязательно подпишитесь на обновления блога и делитесь информацией с друзьями. До скорых встреч!

границ | Влияние отдельных аминокислот на рост и производство летучих ароматов штаммами Saccharomyces cerevisiae

Введение

Во время брожения дрожжи поглощают и метаболизируют аминокислоты и другие питательные вещества для поддержки роста и производства биомассы. В процессе образуется ряд летучих ароматических соединений, включая сложные эфиры, высшие спирты, летучие жирные кислоты, карбонилы и соединения серы. Производство многих из этих соединений, влияющих на аромат, напрямую зависит от источников азота, присутствующих во время ферментации (Dickinson et al., 1997; Эрнандес-Орте и др., 2002; Миллер и др., 2007; Стигер и др., 2011; Торреа и др., 2011; Gutiérrez et al., 2012; Сильва Феррейра и др., 2014; Бурин и др., 2015; Стрибный и др., 2015). Частично по этой причине метаболическая судьба и эффективность аминокислот были тщательно изучены (Cooper, 1982; Monteiro and Bisson, 1992; Godard et al., 2007; Crépin et al., 2012, 2017; Ljungdahl and Daignan- Форнье, 2012). Однако наше понимание метаболической регуляции этих путей остается ограниченным, как и наша способность прогнозировать ароматический результат ферментации на основе химического состава виноградного сусла.

Концентрация и состав азота виноградного сусла сильно различаются, что влияет на метаболизм дрожжей и, следовательно, на аромат вина (Bell and Henschke, 2005). Saccharomyces cerevisiae по-разному использует аминокислоты, которые были классифицированы в соответствии с их способностью поддерживать рост, измеренной по времени генерации, когда они присутствуют в качестве единственного источника азота (Cooper, 1982; Ljungdahl and Daignan-Fornier, 2012). Аланин, аргинин, аспарагин, аспартат, глутамат, глутамин и серин были классифицированы как предпочтительные источники азота, а все другие источники азота как промежуточные или нежелательные (Ljungdahl and Daignan-Fornier, 2012).Эти исследования предоставляют важные базовые наборы данных для выяснения влияния аминокислотного состава на рост дрожжей. Однако такие исследования в основном проводились с лабораторными штаммами и в условиях, сильно отличающихся от тех, что встречаются при виноделии.

Влияние сложных смесей аминокислот в настоящем и синтетическом виноградном сусле на синтез ароматических метаболитов было предметом обширных исследований (Hernández-Orte et al., 2002, 2006; Garde-Cerdán and Ancín-Azpilicueta, 2008; Barbosa и другие., 2009). Многие из открытий связывают образование различных ароматических соединений, таких как сивушные спирты и сивушные кислоты, с разложением аминокислот с разветвленной цепью и ароматических (BCAA) аминокислот по пути Эрлиха (Ehrlich, 1907; Hazelwood et al., 2008). Метаболизм азота очень сложен, поскольку его промежуточные соединения также используются другими путями метаболизма, включая углеродный метаболизм. Следовательно, различные обработки азотом и среды для ферментации, используемые в различных исследованиях, до сих пор не дали полного понимания влияния аминокислотного состава на образование ароматических соединений в условиях ферментации.По-прежнему невозможно предсказать ароматический выход штамма дрожжей в среде со сложной смесью азота, даже если среда ферментации полностью описана. Следовательно, важно установить базовый набор данных для оценки того, как отдельные аминокислоты влияют на рост дрожжей и формирование аромата в условиях ферментации, и установить, в какой степени такие данные могут быть экстраполированы для прогнозирования производства ароматических соединений при более сложном азоте. используются источники. Насколько нам известно, это первое исследование, которое обеспечивает всесторонний анализ кинетики роста коммерческих штаммов винных дрожжей в ответ на отдельные аминокислоты, а также оценку взаимосвязи между концентрацией аминокислот и образованием летучих соединений в простых и других случаях. комплексные матрицы.

Материалы и методы

Штаммы дрожжей

Были использованы два промышленных штамма S. cerevisiae VIN13 (Anchor Yeast, Кейптаун, Южная Африка) и BM45 (Lallemand Inc., Монреаль, Канада) из-за отмеченных различий в кинетике ферментации и получаемых профилях аромата. Процедура предварительного культивирования была следующей: единственную дрожжевую колонию инокулировали в 100 мл YPD и инкубировали в течение ночи при перемешивании при 30 ° C. Культуры центрифугировали, промывали стерильной дистиллированной водой и использовали для инокуляции 100 мл бульона YPD при OD 600 нм 0.1 (приблизительно 10 6 КОЕ / мл) и снова инкубировали в течение ночи при 30 ° C. Затем клетки центрифугировали, промывали и ресуспендировали в стерильной дистиллированной воде. Затем ферментационную среду инокулировали с оптической плотностью 0,1 при 600 нм.

Медиа

Для этого исследования использовали две среды для ферментации; Дрожжевая азотная основа (YNB) без аминокислот и аммония (Difco ™ Laboratories) и синтетическое виноградное сусло (SGM) (Henschke and Jiranek, 1993).

Ферментации (100 мл) проводили в трех повторностях при 30 ° C.Среда содержала 10% (м / об) глюкозы, чтобы гарантировать завершение спиртовой ферментации, и исходный pH был доведен до 3,8 с помощью КОН или HCl. Источником используемого аммония (Nh5 +) был сульфат аммония, если не указано иное.

Среда YNB содержала одну из 19 аминокислот или Nh5 + в качестве единственного источника ассимилируемого дрожжами азота (YAN) в концентрации 10,71 ммоль N / л.

SGM содержал кислоты (3,0 г / л винной кислоты калия, 2,5 г / л L-яблочной кислоты и 0.2 г / л лимонной кислоты), соли (1,14 г / лK 2 HPO 4 , 1,23 г / л MgSO 4 .7H 2 O и 0,44 г / л CaCl 2 .2H 2 O), микроэлементы (200 мкг / л MnCl 2 .4H 2 O, 135 мкг / л ZnCl 2 , 30 мкг / л FeCl 2 , 15 мкг / л CuCl 2 , 5 мкг / лH 3 BO 3 , 30 мкг / л Co [NO 3 ] 2 .6H 2 O, 25 мкг / л NaMoO 4 .2H 2 O и 10 мкг / Л КИО 3 ), витамины (100 мг / л мио-инозитола, 2 мг / л придоксина.HCl, 2 мг / л никотиновой кислоты, 1 мг / л пантотената Са, 0,5 мг / л тиамина. HCl, 0,2 мг / л парааминобензойной кислоты, 0,2 мг / л рибофлавина, 0,125 мг / л биотина и 0,2 мг / л. L фолиевая кислота), анаэробные факторы (10 мг / л эргостерина и 0,5 мл / л Tween 80) и источники азота, как указано. SGM содержал общий YAN 21,43 ммоль N / л, содержащий одну BCAA; фенилаланин, изолейцин, лейцин или валин в концентрациях 7,14, 14,28 и 21,43 ммоль N / л (таблица 1). Обработка BCAA при необходимости дополнялась Nh5 + до общего содержания азота 21.43 ммоль н / л. Дополнительный набор обработок валином был дополнен аланином вместо аммония, чтобы исследовать влияние различных добавок аммония. Дополнительные контрольные обработки содержали только Nh5 + или аланин в качестве единственного источника азота в концентрации 21,43 ммоль N / л.

Таблица 1 . Обработка аминокислот, содержащая различные концентрации разветвленной или ароматической аминокислоты и дополненная Nh5 + или аланином для получения общего YAN 21.43 ммоль н / л.

Третий набор ферментаций был проведен в SGM, содержащем 20% сахаров и 200 мг N / л азота. Азотный состав состоял из хлорида аммония (3,57 мг N / л), изолейцина (2,41 мг N / л), лейцина (2,41 мг N / л), фенилаланина (2,41 мг N / л), тирозина (2,41 мг N / л). и валин (2,41 мг N / л).

Последний набор ферментаций был проведен в SGM, как описано выше, однако в этом случае использовались более сложные смеси азота (таблица 2). Содержание YAN 14.Использовали 3 ммоль N / л, из которых 3,57 ммоль N / л приходилось на хлорид аммония, остаток составляли все аминокислоты, причем каждая аминокислота обеспечивала равные количества ферментируемого азота. Кроме того, один BCAA (лейцин, изолейцин, валин, фенилаланин, тирозин и триптофан) либо присутствовал в той же концентрации, что и другие аминокислоты, отсутствовал (0) или присутствовал в концентрации, вдвое превышающей (2) концентрацию других аминокислот. . Ферментацию проводили в трех экземплярах при 20 ° C без перемешивания.

Таблица 2 . Ферментация содержала 14,3 ммоль N / л YAN, из которых 3,57 ммоль N / л -1 были обеспечены хлоридом аммония, остаток состоял из всех перечисленных аминокислот, каждая из которых обеспечивала равное количество ферментируемого азота, за исключением лейцин, изолейцин, валин, фенилаланин, тирозин и триптофан, которые также либо отсутствовали (0), либо присутствовали в концентрации, вдвое превышающей (2) другие аминокислоты.

Параметры роста

Биомасса

Оптическая плотность, измеренная на длине волны 600 нм (OD 600 нм ), использовалась в качестве индикатора накопления биомассы во время ферментации, и образцы отбирали каждые 2–4 часа в течение первых 20 часов, а затем каждые 6–24 часа до тех пор, пока похудание прекратилось.Два миллилитра среды были собраны в асептических условиях из сосуда для ферментации, центрифугированы при 5000 об / мин в течение 5 минут, и супернатант был удален. Гранулы ресуспендировали в дистиллированной воде, центрифугировали и снова промывали. Образцы сушили 48 ч при 100 ° C и взвешивали. Чтобы получить калибровочную кривую для биомассы, сухой вес наносили на график зависимости от значения OD в каждой из этих точек отбора проб.

Экспоненциальная скорость роста и фаза запаздывания

Среднюю экспоненциальную скорость роста определяли, выполняя полулогарифмическое преобразование кривой роста каждой отдельной аминокислотной обработки.Из этой преобразованной кривой роста был выделен линейный участок, добавлена ​​линия тренда, и ее градиент представлял экспоненциальную скорость роста. Поскольку лаг-фаза заканчивается там, где начинается фаза экспоненциального роста, за среднюю лаг-фазу принимали период между временем инокуляции и началом экспоненциального роста.

Время до завершения брожения

Сосуды для ферментации взвешивали каждые 24 ч до тех пор, пока потеря веса не перестанет быть обнаружена.

Газовая хроматография с детектором ионизации пламенем (GC-FID)

В конце спиртовой ферментации образцы подвергали жидкостно-жидкостной экстракции, как описано Louw et al.(2009) для анализа методом газовой хроматографии. Образец среды объемом 5 мл, 100 мкл внутреннего стандарта (4-метил-2-пентанол) и 1 мл растворителя (диэтиловый эфир) объединяли, а затем помещали в ультразвуковую баню на 5 мин для облегчения экстракции. Затем смесь центрифугировали в течение 3 мин при 4000 об / мин, после чего добавляли Na 2 SO 4 для удаления воды из неполярного слоя, и образец снова центрифугировали еще 3 мин при 4000 об / мин. Для количественного определения основных летучих веществ использовали прибор Hewlett Packard 6890 Plus GC-FID (Agilent, Little Falls, Wilmington, USA) с инжектором с разделением / без разделения.Скорость разделения потока была установлена ​​на 49,4 мл / мин, а соотношение разделения было установлено на 15: 1 при температуре 200 ° C. Разделение соединений проводили с использованием капиллярной колонки для ГХ J и B DBFFAP (Agilent, Little Falls, Wilmington, США) с размерами 60 м × 0,32 мм и толщиной пленки покрытия 0,5 мкл с расходом газа-носителя водорода. установлен на 3,3 мл / мин. Как только температура печи FID достигла 240 ° C, 3 мкл экстрагированного образца вводили в газовый хроматограф при начальной температуре 33 ° C и выдерживали в течение 8 мин; затем температуру повышали на 21 ° C / мин до 130 ° C и затем поддерживали в течение 17 минут; увеличивали на 12 ° C / мин до 170 ° C и выдерживали 5 мин; увеличивалась на 21 ° C / мин до 240 ° C и выдерживалась 2.5 мин. Последующий прогон в конце каждого образца выполняли при 240 ° C в течение 5 минут. Каждый образец вводили в двух экземплярах. Колонку очищали введением гексана после каждых 20 проб. Ручной сбор данных и интеграция пиков выполнялись с помощью программного обеспечения HP ChemStation [Rev. B01.03 (204)].

Прогноз производства ароматических соединений

Для оценки функциональной взаимосвязи между конечной концентрацией BCAA и накоплением связанных с ними летучих метаболитов была принята линейная взаимосвязь, и был проведен регрессионный анализ для определения взаимосвязи.

Предполагаемую взаимосвязь можно резюмировать следующим уравнением:

Где Y = концентрация метаболита; b = уклон склона; X = концентрация аминокислоты; a = концентрация метаболита, когда аминокислота не добавляется.

Различные концентрации BCAA были нанесены на график против их соответствующих ароматических соединений, и сила регрессионной модели представляет предсказуемость производства ароматических соединений в зависимости от начальной концентрации.

Статистический анализ

тепловых карт автомасштабируемых данных GC-FID было построено с использованием пакета Complex Heatmap в R studio, где применимо, строки и столбцы были сгруппированы с использованием Ward.D и метрики евклидова расстояния. Аналогичным образом кластерный анализ применялся к четырем измеренным параметрам роста дрожжей.

Результаты

Влияние отдельных аминокислот на кинетику роста

Отдельные аминокислоты оценивали на их способность поддерживать рост VIN13 и BM45 в YNB.Различия в кинетике роста наблюдались как из-за обработки аминокислотами, так и, в меньшей степени, из-за штамма дрожжей. Оценивали четыре параметра роста: продолжительность лаг-фазы, экспоненциальную скорость роста, общее образование биомассы и время до завершения ферментации (Рисунки 1A – D). В большинстве случаев, как и ожидалось, четыре параметра демонстрировали сильную корреляцию с короткой лаг-фазой, коррелирующей с быстрым экспоненциальным ростом и высоким общим образованием биомассы, а также с более коротким временем ферментации.В большинстве случаев; оба штамма также вели себя одинаково, но наблюдались некоторые существенные исключения.

Рисунок 1 . Сравнение накопления биомассы (A) , экспоненциальной скорости роста (B) , оценка лаг-фазы (C) и продолжительности ферментации (D) VIN13 (светло-серый) и BM45 (темно-серый) в культуре в YNB, содержащем одну аминокислоту или аммоний. Планки погрешностей обозначают стандартное отклонение трехкратной ферментации.Тепловая карта (E) суммирует все четыре измеренных параметра роста, где высокие значения окрашены в красный цвет, а низкие - в синий, а интенсивность цвета представляет собой изменение уровней по цветовой шкале.

Глутамат, предпочтительный источник азота, привел к самой короткой лаг-фазе (Рисунок 1C) у обоих штаммов, а также к быстрой экспоненциальной скорости роста (Рисунок 1B), образованию большого количества биомассы (Рисунок 1A) и короткой продолжительности ферментации (Рисунок 1D). . Глутамин, аргинин, аланин, серин, аспартат, фенилаланин и валин также в целом подтверждали сходные закономерности (рис. 1E).Однако между двумя штаммами наблюдались некоторые существенные различия, поскольку глутамат и аспарагин приводили к очень разным показателям экспоненциального роста BM45, оставаясь очень похожими в случае VIN13 (рис. 1B).

Для некоторых аминокислот общая корреляция между четырьмя параметрами не сохранялась. Это иллюстрируется изолейцином, который давал биомассу, сопоставимую с предпочтительными аминокислотами, такими как аргинин, но приводил к низкой экспоненциальной скорости роста и большой продолжительности ферментации (рис. 1E).

Обработка триптофаном, треонином и аспарагином привела к самым низким уровням продукции биомассы для обоих штаммов дрожжей (рис. 1A). Штамм дрожжей значительно повлиял на производство биомассы, что видно при обработке аргинина, изолейцина, лейцина, треонина, тирозина, метионина и Nh5 + с VIN13, что привело к снижению конечной биомассы (рис. 1A).

Как показано на тепловой карте, изолейцин, тирозин, метионин, пролин, лейцин и триптофан показали сравнительно более слабые характеристики по всем четырем оцененным параметрам роста по сравнению с предпочтительными аминокислотами, обнаруженными в первом кластере.

Аспарагин, треонин и аммиак находятся в третьем кластере, так как у них были короткие лаг-фазы, несмотря на низкие уровни производства биомассы. Аммиак считается предпочтительным источником азота, и поэтому его плохие характеристики были дополнительно исследованы, и это отклоняющееся поведение было приписано буферной способности используемой среды YNB (данные не показаны).

Штаммы дрожжей также по-разному реагировали на определенные обработки азотом, о чем свидетельствуют более длительные лаг-фазы, наблюдаемые для VIN13 при добавлении только треонина, изолейцина и триптофана (рис. 1C).Наибольшая скорость роста наблюдалась у штамма BM45 при обработке глутаматом (рис. 1В). Более низкие скорости роста наблюдались у обоих штаммов при лечении Nh5 +, треонином, пролином, метионином, лейцином, тирозином, изолейцином и триптофаном.

Влияние отдельных аминокислот на производство аромата

Как и ожидалось, на состав летучих соединений сильно повлияла предоставленная аминокислота (21,43 ммоль N / л) (рис. 2). Обработка разветвленных цепей и ароматических аминокислот приводила к высоким концентрациям сивушных спиртов и сивушных кислот, в основном в соответствии с известными метаболическими путями.Обработка валином привела к высокому производству изобутанола (4,4 ммоль / л) и изомасляной кислоты, где VIN13 продуцировал 1,57 ммоль / л, а BM45 - 1,99 ммоль / л (Фигуры 2I, J). Обработка лейцином и изолейцином была связана с производством изоамилового спирта, изовалериановой кислоты и изоамилацетата (Рисунки 2E – G). Продукты катаболизма изолейцина (амиловый спирт и 2-метилбутановая кислота) и лейцина (изоамиловый спирт и изовалериановая кислота) имеют сходную структуру и, следовательно, одинаковое время удерживания. Неправильная идентификация метаболитов, скорее всего, является причиной того, что профиль так сильно напоминает профиль лейцина.Метаболизм фенилаланина привел к продукции более 5 ммоль / л 2-фенилэтанола обоими штаммами и 0,17 ммоль / л 2-фенилэтилацетата посредством VIN13 и 0,23 ммоль / л посредством BM45 (Фигуры 2A, B). Катаболизм треонина привел к образованию пропанола, но также привел к самым высоким уровням бутанола и пропионовой кислоты, умеренным уровням изоамилового спирта, изовалериановой кислоты, уксусной кислоты и этилацетата (Рисунки 2C – F и H).

Рисунок 2 . Влияние отдельных аминокислот в YNB на производство летучих соединений VIN13 (светло-серый) и BM45 (темно-серый) на производство летучих соединений (ммоль / л), таких как 2-фенилэтанол (A) , 2- фенилэтилацетат (B) , уксусная кислота (C) , этилацетат (D) , изоамиловый спирт (E) , изовалериановая кислота (F) , изоамилацетат (G) , пропионовая кислота (H) , изобутанол (I) и изомасляная кислота (J) .Планки погрешностей обозначают стандартное отклонение трехкратной ферментации.

Оценка производства аромата на основе концентрации BCAA

Влияние отдельных BCAA на биосинтез аромата было дополнительно исследовано с использованием VIN13 в синтетическом виноградном сусле. Применяли три концентрации аминокислот, поддерживая общий доступный азот за счет добавления аммония. Чтобы оценить, может ли изменение концентрации аммония повлиять на результат, те же данные были получены с использованием аланина вместо аммония.Летучая кислотность (уксусная кислота и этилацетат) показывает пропорциональную реакцию на добавку аммония (Таблица S2), тогда как пропанол показывает обратную зависимость от добавок (Рисунок 3G).

Рисунок 3 . Влияние увеличения концентрации BCAA в синтетическом виноградном сусле на образование летучих соединений по VIN13: 2-фенилэтанол (A) , 2-фенилэтилацетат (B) , изоамиловый спирт (C) , изовалериановая кислота (D) , пропионовая кислота (E) , бутанол (F) , пропанол (G) и изобутанол (H) .Планки погрешностей обозначают стандартное отклонение трехкратной ферментации.

Данные свидетельствуют о существовании линейной корреляции, следовательно, данные были использованы для разработки простой регрессионной модели для оценки продукции ароматических соединений на основе исходной концентрации аминокислот (Таблица 3).

Таблица 3 . Линейный регрессионный анализ взаимосвязи между BCAA и соответствующим летучим метаболитом, продуцируемым VIN13 во время ферментации.

Независимо от добавления аммиака или аланина ферментация валина реагировала аналогичным образом в отношении изобутанола и изомасляной кислоты, тогда как на уровни бутанола и пропионовой кислоты значительно влияли уровни аммония (Рисунки 3E, F, H).

Как показано на Рисунке 2 (Таблица S1), эти ферментации SGM показали аналогичную реакцию на добавку BCAA. Линейная корреляция между концентрацией аминокислоты и производством сивушных спиртов и сивушных кислот наблюдалась при индивидуальном изменении начальных концентраций BCAA (рис. 3, таблица S2). Некоторые летучие соединения, относящиеся к валину (изомасляная кислота и масляная кислота), фенилаланину (2-фенилэтанол и валериановая кислота) и лейцину (изоамиловый спирт), можно предсказать с помощью корреляционного анализа.Хотя другие ароматические соединения имели высокие коэффициенты регрессии (R 2 ), наклоны были незначительными (Таблица 3). Удивительно, но общий выход ароматических соединений, в первую очередь высшего спирта, был идентичен по концентрации общему количеству лейцина и фенилаланина (таблица 4). Это может указывать на то, что вклад других метаболических путей в эти ароматические соединения незначителен в этих условиях или может быть случайным совпадением. В случае валина измеренные катаболические продукты составляют от 58 до 76% от начальной концентрации, но мы не измеряли некоторые из основных продуктов распада в этом случае.

Таблица 4 . Выход летучих ароматов (%) основан на концентрации BCAA и связанных летучих метаболитов, продуцируемых VIN13 во время ферментации.

Чтобы оценить эффективность этих регрессионных моделей, ферментации проводили с использованием более сложных смесей аминокислот. Эти ферментации содержали BCAA, изолейцин, лейцин, фенилаланин, тирозин и валин, и прогнозируемые концентрации ароматических соединений были определены с использованием уравнений в таблицах 3, 5.В этой сравнительно простой матрице фактические определенные концентрации отличались от прогнозируемых значений, что указывает на то, что предсказательная способность линейного корреляционного анализа уже утрачена.

Таблица 5 . Сравнение фактических и прогнозируемых концентраций летучих метаболитов в ответ на смеси BCAA, продуцируемые VIN13 во время ферментации.

Влияние изменения концентрации одной аминокислоты в сложной смеси на производство аромата

Чтобы оценить влияние относительно незначительных изменений в аминокислотном составе, которые более точно имитируют виноградное сусло, ферментацию проводили с использованием 19 аминокислот, но варьируя только одну BCAA (лейцин, изолейцин, валин, фенилаланин, тирозин и треонин) концентрация.Для каждой из этих аминокислот использовали три концентрации: отсутствует (0), такая же, как и для всех других аминокислот, и присутствует в концентрации, в два раза (2) превышающей концентрацию других аминокислот. Влияние этого упущения или удвоенной концентрации BCAA на производство ароматических соединений было оценено в более сложном синтетическом виноградном сусле (20% сахаров). Обработка аминокислотами приводила к сходной кинетике ферментации, при этом обработка аммонием происходила сравнительно медленнее, тем не менее, все ферментации проходили до сухости (<2 г / л остаточного сахара, данные не показаны).

Полученные концентрации отличались от рассчитанных прогнозируемых уровней, что свидетельствует о потере линейной предсказуемости. Тем не менее, данные показывают, что эти индивидуальные аминокислотные изменения действительно вызывают значительные изменения в продуцируемых соединениях, связанные с их катаболизмом (рис. 4, таблица S3). Это ясно иллюстрируется реакцией на добавление лейцина (изоамилацетат), фенилаланина (2-фенилэтанол и 2-фенилэтилацетат) и валина (изобутанол и изомасляная кислота), где ожидаемое увеличение (2 лечения) или снижение (0 процедур) наблюдались.По сравнению с обработкой всеми аминокислотами (0,59 ммоль N / л) отсутствие фенилаланина привело к 56% снижению продукции 2-фенилэтанола и 46% снижению 2-фенилэтилацетата. Напротив, удвоенная концентрация фенилаланина (1,13 ммоль Н / л) приводила к увеличению на 127% производства 2-фенилэтанола и к увеличению на 110% 2-фенилэтилацетата. Точно так же отсутствие валина привело к снижению изобутанола на 24% и изомасляной кислоты на 13%, а также к удвоению концентрации валина (1.13 ммоль N / л) вызывает 80% -ное увеличение изобутанола и изомасляной кислоты. Отсутствие или двукратное увеличение концентрации триптофана и тирозина привело лишь к незначительным изменениям в производстве летучих жирных кислот и этиловых эфиров. Обработка аммонием вырабатывала высокие уровни пропанола, пропионовой кислоты, 3-этокси-1-пропанола и бутанола, что также видно на Фигуре 3, и очень низкие уровни метаболитов, полученных в результате метаболизма фенилаланина и валина.

Рисунок 4 . Воздействие отсутствия (0) или удвоенной концентрации азота (1.13 ммоль N / л) (2) обеспечивается BCCA, когда все другие аминокислоты обеспечивают такое же количество ферментируемого азота при производстве летучих соединений (ммоль / л). Ферментация, опосредованная VIN13, проводилась в синтетическом виноградном сусле.

Обсуждение

В контексте виноделия азот играет двойную роль, способствуя росту дрожжей для достижения завершения алкогольного брожения, но также играя центральную роль в производстве летучих ароматов. В предыдущих исследованиях время генерации использовалось для оценки эффективности источников азота для поддержки роста (Cooper, 1982; Godard et al., 2007). Это исследование увеличило количество оцениваемых параметров роста, что позволило провести более тщательное и полное изучение эффективности отдельных аминокислот в контексте конкретного вина. Поскольку аминокислоты являются единственным источником азота, присутствие других источников азота не влияет на регулятивное воздействие на их использование (Godard et al., 2007; Ljungdahl and Daignan-Fornier, 2012). В целом, аминокислотная эффективность, наблюдаемая в условиях ферментации, согласуется с предыдущими исследованиями Cooper (1982) и Godard et al.(2007). Предпочтительными источниками азота, которые лучше всего поддерживают кинетику ферментации (аланин, аргинин, аспартат, глутамин, глутамат и серин), также являются аминокислоты, которые легко включаются в метаболические пути клетки. В отличие от предыдущих результатов, обработка фенилаланином и валином напоминала предпочтительные аминокислоты, тогда как аспарагин был плохим источником азота из-за его способности поддерживать рост дрожжей. Эти различия в классификации аминокислот можно объяснить разными условиями ферментации, используемыми штаммами винных дрожжей, а также дополнительными оцененными параметрами.

В целом, образование биомассы обычно коррелировало с продолжительностью лаг-фазы, а скорость экспоненциального роста коррелировала со временем ферментации. Исключения из этих корреляций из-за различий штаммов были обнаружены как для биомассы и лаг-фазы (обработка аргинином, изолейцином и треонином), так и для экспоненциальной скорости роста и времени ферментации (обработка валином и треонином). Кроме того, было обнаружено, что аспарагин является исключением из-за его нерегулярных характеристик по всем оцениваемым параметрам.В контексте виноделия включение времени ферментации и биомассы позволяет лучше понять влияние этих отдельных аминокислот на эффективность ферментации.

Тип и количество продуцируемых летучих соединений в значительной степени зависят от аминокислоты, штамма дрожжей и их взаимодействия. В целом аналогичные ответы на обработку азотом наблюдались для большинства соединений, однако штаммы часто различались по величине их ответов на некоторые применяемые обработки аминокислот.В соответствии с литературными данными, разложение BCAA до соответствующих сивушных спиртов и сивушных кислот было положительно связано (Hazelwood et al., 2008). Интересно, что валин был единственной аминокислотой, которая приводила к менее чем 100% конверсии в родственные ей летучие соединения. Это говорит о том, что дрожжи перенаправили альфа-кетокислоту (α-кето-изовалерат) на другой метаболический путь, возможно, на биосинтез лейцина. Принимая во внимание, что независимо от его концентрации лейцин и фенилаланин приводили к полному превращению аминокислоты в летучие продукты распада, что позволяет предположить, что все аминокислоты были синтезированы de novo (Crépin et al., 2017). Следовательно, когда отдельные BCAA используются вместе с аммонием в качестве единственного другого источника азота, производство ароматических соединений демонстрирует сильную линейную корреляцию между концентрацией аминокислоты и соответствующего летучего соединения (рис. 3). Последующий регрессионный анализ выявил потенциал использования концентрации аминокислот для прогнозирования концентрации связанного летучего соединения (таблица 4), однако только изоамиловый спирт, изомасляная кислота, масляная кислота, 2-фенилэтанол и валериановая кислота могут быть надежно предсказаны с использованием регрессионные модели.Принимая во внимание взаимосвязь азотного метаболизма, неудивительно, что когда все BCAA используются вместе, линейная взаимосвязь теряется, что приводит к плохой предсказуемости (Рисунок 4). Как правило, аминокислоты катаболизируются с образованием глутамата, который играет центральную роль в биосинтезе аминокислот, и углеродного скелета, который может вступать в цикл TCA, путь Эрлиха или использоваться для биосинтеза других аминокислот, как в случае с лейцином и валин (Магасаник, Кайзер, 2002). Следовательно, в отсутствие лейцина можно было бы предположить снижение уровней летучих соединений, связанных с катаболизмом валина, поскольку клетка предположительно будет использовать углеродный скелет для производства лейцина вместо сивушного спирта или кислоты (рис. 4).Это не так, как объясняют Крепин и др. (2017) в недавнем исследовании по мониторингу судьбы аминокислот, которое показало, что предшественники α-кетокислоты, используемые для более высокого производства алкоголя, обычно происходят из сахара, а не из катаболизма аминокислот. Данные, представленные здесь (Рисунок 4), показывают, что даже сравнительно небольшие изменения в концентрациях BCAA все же приводят к значительному влиянию на производство связанных летучих соединений, даже если они представлены в сложных смесях и в присутствии всех аминокислот.Тем не менее, в работе Crépin et al. (2017) вызывает беспокойство по поводу того, что внесение питательных веществ во время виноделия может не вносить прямого вклада в профиль летучих, но данные, представленные здесь, ясно показывают, что это не так, поскольку степень чувствительности даже к незначительным изменениям в отдельных аминокислотах добавление привело к прямому влиянию на производство связанных ароматических соединений. В будущей работе будет изучаться прогнозное моделирование воздействия сложного состава азота на метаболические продукты.

Это исследование обеспечивает новую оценку влияния отдельных аминокислот на несколько параметров роста, в дополнение к их влиянию на продукцию летучих метаболитов двумя генетически разными промышленными штаммами S. cerevisiae , которые, как известно, имеют разную кинетику ферментации и летучие профили аромата (Rossouw and Bauer, 2009). Различные корреляции между концентрацией аминокислот и летучими соединениями варьировались от линейной в простейшем из всех случаев (одна аминокислота) до непредсказуемой в более сложных средах.Однако, что важно, относительно незначительные изменения концентраций отдельных аминокислот все же приводили к изменениям в вариации производных летучих соединений.

Авторские взносы

SF и AM провели эксперименты, проанализировали данные и написали рукопись; HM и AF написали рукопись; FB разработал эксперименты, внес свой вклад в интерпретацию данных, руководил исследованием и стал соавтором рукописи.

Заявление о конфликте интересов

Авторы заявляют, что исследование проводилось при отсутствии каких-либо коммерческих или финансовых отношений, которые могут быть истолкованы как потенциальный конфликт интересов.

Благодарности

Финансирование исследования, представленного в этой статье, было предоставлено Национальным исследовательским фондом (NRF) Южной Африки через грант SARChI 83471 и Winetech, организацией, финансирующей исследования винодельческой отрасли Южной Африки.

Дополнительные материалы

Дополнительные материалы к этой статье можно найти в Интернете по адресу: https://www.frontiersin.org/articles/10.3389/fmicb.2017.02554/full#supplementary-material

Список литературы

Барбоса, К., Фалько, В., Мендес-Файя, А., Мендес-Феррейра, А. (2009). Добавление азота влияет на образование ароматических соединений, летучей кислотности и этанола в средах с дефицитом азота, ферментированных винными штаммами Saccharomyces cerevisiae . J. Biosci. Bioeng. 108, 99–104. DOI: 10.1016 / j.jbiosc.2009.02.017

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Белл, С. Дж., И Хеншке, П. А. (2005). Влияние азотного питания на виноград, ферментацию и вино. Aust. J. Виноградное вино Res . 11, 242–295. DOI: 10.1111 / j.1755-0238.2005.tb00028.x

CrossRef Полный текст | Google Scholar

Бурин В. М., Гомеш Т. М., Калиари В., Розье Дж. П. и Бординьон Луис М. Т. (2015). Установление влияния содержания азота в сусле и профиля летучести белых вин, связанных с хемометрическими приборами. Microchem. J. 122, 20–28. DOI: 10.1016 / j.microc.2015.03.011

CrossRef Полный текст | Google Scholar

Купер, Т.Г. (1982). Метаболизм азота в Saccharomyces cerevisiae . Колд Спринг Харбор Моногр. Arch. 11, 39–99. DOI: 10.1101 / 087969180.11B.39

CrossRef Полный текст

Крепен, Л., Ниделет, Т., Санчес, И., Декин, С., и Камараса, К. (2012). Последовательное использование соединений азота Saccharomyces cerevisiae во время ферментации вина: модель, основанная на кинетических и регулирующих характеристиках азотных пермеаз. заявл. Environ. Microbiol. 78, 8102–8111. DOI: 10.1128 / AEM.02294-12

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Крепен, Л., Труонг, Н. М., Блум, А., Санчес, И., Декин, С., и Камараса, К. (2017). Управление несколькими источниками азота во время ферментации вина S. cerevisiae . заявл. Environ. Микробиол . 83, e02617 – e02616. DOI: 10.1128 / AEM.02617-16

CrossRef Полный текст | Google Scholar

Дикинсон, Дж. Р., Лантерман, М. М., Даннер, Д. Дж., Пирсон, Б. М., Санс, П., Харрисон, С. Дж. И др. (1997). Ядерно-магнитно-резонансное исследование 13C метаболизма лейцина в изоамиловый спирт в Saccharomyces cerevisiae . J. Biol. Chem. 272, 26871–26878. DOI: 10.1074 / jbc.272.43.26871

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Эрлих, Ф. (1907). Über die Bedingungen der Fuselölbildung und über ihren Zusammenhang mit dem Eiweissaufbau der Hefe. Ber Dtsch Chem Ges .40, 1027–1047. DOI: 10.1002 / cber.1

001156

CrossRef Полный текст | Google Scholar

Монтейро, Ф. Ф., и Биссон, Л. Ф. (1992). Добавление азота в виноградный сок. I. Влияние на утилизацию аминокислот во время ферментации. г. J. Enol. Витич. 43, 1–10.

Google Scholar

Garde-Cerdán, T. и Ancín-Azpilicueta, C. (2008). Влияние добавления различных количеств аминокислот к азотодефицитному суслу на образование сложных эфиров, спиртов и кислот во время спиртового брожения вина. LWT-Food Sci. Технол . 41, 501–510. DOI: 10.1016 / j.lwt.2007.03.018

CrossRef Полный текст | Google Scholar

Godard, P., Urrestarazu, A., Vissers, S., Kontos, K., Bontempi, G., van Helden, J., et al. (2007). Влияние 21 различных источников азота на глобальную экспрессию генов в дрожжах Saccharomyces cerevisiae . Мол. Клетка. Биол. 27, 3065–3086. DOI: 10.1128 / MCB.01084-06

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Гутьеррес, А., Чива, Р., Санчо, М., Белтран, Г., Арройо-Лопес, Ф. Н., и Гийамон, Дж. М. (2012). Потребность коммерческих штаммов винных дрожжей в азоте во время брожения синтетического виноградного сусла. Пищевой микробиол . 31, 25–32. DOI: 10.1016 / j.fm.2012.02.012

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Хейзелвуд, Л. А., Даран, Дж. М., ван Марис, Дж. А., Пронк, Дж. Т., и Дикинсон, Дж. Р. (2008). Путь Эрлиха для производства сивушного спирта: столетие исследований метаболизма Saccharomyces cerevisiae . заявл. Environ. Микробиол . 74: 2259. DOI: 10.1128 / AEM.00934-08

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Henschke, P. A., and Jiranek, V. (1993). «Дрожжи-метаболизм соединений азота», в Винная микробиология и биотехнология , изд. Г. Х. Флит (Chur: Harwood Academic Publishers), 77–164.

Эрнандес-Орте, П., Качо, Дж. Ф. и Феррейра, В. (2002). Взаимосвязь между сортовым аминокислотным профилем винограда и ароматическим составом вина.эксперименты с модельными растворами и хемометрические исследования. J. Agric. Продовольственная химия . 50, 2891–2899. DOI: 10.1021 / jf011395o

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Эрнандес-Орте, П., Ибарз, М. Дж., Качо, Дж., И Феррейра, В. (2006). Добавление аминокислот в виноградный сок сорта Мерло: влияние на усвоение аминокислот и формирование аромата при спиртовой ферментации. Food Chem . 98, 300–310. DOI: 10.1016 / j.foodchem.2005.05.073

CrossRef Полный текст | Google Scholar

Ljungdahl, P.О., и Дайньян-Форнье, Б. (2012). Регулирование метаболизма аминокислот, нуклеотидов и фосфатов в Saccharomyces cerevisiae . Генетика 190, 885–929. DOI: 10.1534 / genetics.111.133306

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Louw, L., Roux, K., Tredoux, A., Tomic, O., Naes, T., Nieuwoudt, H.H., et al. (2009). Характеристика отобранных молодых сортов вин Южной Африки с использованием FTMIR-спектроскопии, газовой хроматографии и многомерного анализа данных. J. Agric. Food Chem. 57, 2623–2632. DOI: 10.1021 / jf8037456

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Миллер А. С., Вольф С. Р., Биссон Л. Ф. и Эбелер С. Е. (2007). Штамм дрожжей и азотная добавка: динамика образования летучих эфиров при ферментации сока шардоне. г. J. Enol. Витич . 58, 470–483.

Google Scholar

Россоу Д. и Бауэр Ф. Ф. (2009). Сравнение транскриптомов штаммов винных дрожжей: к пониманию взаимодействия между окружающей средой и транскриптомом во время ферментации. заявл. Environ. Microbiol. 84, 937–954 DOI: 10.1007 / s00253-009-2204-4

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Сильва Феррейра Монфорте, А. Р., Тейшейра, К. С., Мартинс, Р., Фэйрбэрн, С., и Бауэр, Ф. Ф. (2014). Мониторинг алкогольного брожения: нецелевой подход. J. Agric. Food Chem. 62, 6784–6793. DOI: 10.1021 / jf502082z

CrossRef Полный текст | Google Scholar

Стрибны, Дж., Гамеро, А., Перес-Торрадо, Р., и Querol, A. (2015). Saccharomyces kudriavzevii и Saccharomyces uvarum отличаются от Saccharomyces cerevisiae производством ароматически активных высших спиртов и эфиров ацетата с использованием их предшественников аминокислот. Внутр. J. Food Microbiol. 205, 41–46. DOI: 10.1016 / j.ijfoodmicro.2015.04.003

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Торреа Д., Варела К., Ульяно М., Анчин-Аспиликуэта К., Ли Фрэнсис И. и Хеншке П.А. (2011). Сравнение добавок неорганического и органического азота в виноградный сок - Влияние на состав летучих и ароматический профиль вина Шардоне, сброженного дрожжами Saccharomyces cerevisiae . Food Chem. 127, 1072–1083. DOI: 10.1016 / j.foodchem.2011.01.092

PubMed Аннотация | CrossRef Полный текст | Google Scholar

Низкое содержание аминокислот в рационе связано с задержкой роста у детей

Недостаток незаменимых аминокислот и холина в рационе связан с задержкой роста, говорится в исследовании, опубликованном в Интернете в EBioMedicine .Полученные данные могут предложить новые способы помощи миллионам детей, страдающих от недоедания, во всем мире.

Поделиться на Pinterest Четверть детей в мире может нуждаться в большем количестве белка, чтобы способствовать их росту.

Во всем мире 150 миллионов детей недоедают, и около 25% всех детей в возрасте до 5 лет страдают задержкой роста и развития.

Самая очевидная особенность - низкий рост, но другие проблемы связаны с когнитивным развитием и способностью противостоять болезням и инфекциям. Замедленный рост также может сократить продолжительность жизни.

Незаменимые аминокислоты являются строительными блоками белков. Они необходимы для здоровья человека, но должны поступать из пищевых источников, поскольку организм не может их производить.

Источники животного происхождения, такие как яйца и молочные продукты, могут обеспечить необходимые питательные вещества.

Вмешательства в области питания помогли снизить смертность от острого недоедания, но они почти не снизили распространенность задержки роста.

Исследователи из Медицинской школы Вашингтонского университета в Санкт-Петербурге.Луи, штат Миссури, сотрудничал с коллегами из Университета Джона Хопкинса в Балтиморе, штат Мэриленд, и учеными из Национального института старения Национального института здоровья (NIH), Университета Малави и других учреждений, чтобы найти подсказки.

Используя метаболомный подход, который исследует метаболиты, присутствующие в организме, команда исследовала образцы крови 313 детей в возрасте 12-59 месяцев из сельских районов Малави в Африке к югу от Сахары.

Дети, включенные в исследование, не имели признаков тяжелого острого недоедания, врожденных или хронических заболеваний или диареи.

Однако измерения роста и веса показали, что 64% ​​участников были маленькими для своего возраста, на основе кривых, определенных Всемирной организацией здравоохранения (ВОЗ).

Образцы крови показали, что более 80% детей с задержкой роста имели на 15-20% более низкие уровни всех девяти незаменимых аминокислот по сравнению с детьми, которые росли нормально.

У них также были значительно более низкие концентрации других веществ: условно незаменимых аминокислот, заменимых аминокислот и шести сфинголипидов.

Сфинголипиды содержатся в клеточных мембранах, и они сохраняют клеточные мембраны прочными и непроницаемыми, что снижает воздействие микробов.

У детей также наблюдалась необычная концентрация другого липида, связанного с клеточными мембранами в головном мозге и нервной ткани.

Результаты показывают, что дети с риском задержки роста могут не получать в достаточном количестве незаменимые аминокислоты и холин, который необходим для синтеза липидов.

Авторы объясняют, что у детей низкий уровень «всех этих аминокислот и всех этих видов жиров», каждая из которых необходима для включения переключателя для роста.

Команда считает, что недостаток аминокислот может привести к тому, что определенный белковый комплекс, который функционирует как сенсор питательных веществ внутри клеток, будет препятствовать синтезу белков и липидов и росту клеток. Эта же функция регулирует рост костей, который определяет высоту.

Старший соавтор, доктор Марк Дж. Манари из Университета Джона Хопкинса, который проводит несколько месяцев в году в Африке, лечит детей с недоеданием, говорит:

«От задержки роста страдает половина детей в сельских районах Африки и миллионы других детей. в другом месте в мире.Было предпринято много усилий для уменьшения воздействия задержки роста, от введения различных пищевых добавок до снижения подверженности инфекциям, но на самом деле мы ничего не добились. Но эти новые открытия, полученные с помощью передовых технологий, проливают свет на биологические причины этой извечной, глобально значимой проблемы ».

Доктор Ричард Семба из Университета Джона Хопкинса говорит: «Это ставит под сомнение широко распространенное мнение о том, что дети получают достаточно белка в развивающихся странах.Это может вызвать огромный сдвиг в гуманитарном сообществе. Мы должны серьезно подумать о том, чтобы попытаться улучшить диету. Дети не получают качественной еды ».

Команда надеется, что дальнейшие исследования помогут создать средство, будь то пищевой продукт или добавка, для уменьшения задержки роста.

Доктор Манари, который десятилетиями работал над разработкой и поставкой богатых питательными веществами готовых к употреблению продуктов питания (RUTF) в Африке, Азии и Центральной Америке, предполагает, что результаты могут привести к «чему-то аналогичному RUTF, но для задержки роста.”

Медицинские новости Сегодня сообщили в прошлом году, что некоторые лекарства от астмы могут привести к задержке роста.

Аминокислоты и развитие молочных желез: влияние на питание для производства молока и роста новорожденных | Журнал зоотехники и биотехнологии

  • 1.

    Альстрём О., Вамберг С. Потребление молока детенышами голубой лисицы ( Alopex lagopus ) и чернобурки ( Vulpes vulpes ) в ранний период грудного вскармливания. Comp Biochem Physiol A. 2000; 127: 225–36.

    Артикул Google Scholar

  • 2.

    Ашаффенбург Р., Грегори М.Э., Роуленд С.Дж., Томпсон С.И., Кон В.М. Состав молока жирафа ( Giraffa camelopardalis reticulata ). Proc Zool Soc Lond. 1962; 139: 359–63.

    CAS Статья Google Scholar

  • 3.

    Бен Шауль DM. Состав молока диких животных. Ежегодник Международного зоопарка. 1962; 4: 333–42.

    Артикул Google Scholar

  • 4.

    Бонфатти В., Гигантин М., Ростеллато Р., Дакасто М., Карнье П. Разделение и количественная оценка фракций и генетических вариантов белков молока водяных буйволов с помощью ОФ-ВЭЖХ. Food Chem. 2013; 136: 364–7.

    CAS PubMed Статья Google Scholar

  • 5.

    Автобус DH. Исследования белков молока павиана. Comp Biochem Physiol B. 1978; 59: 5–8.

    CAS PubMed Google Scholar

  • 6.

    Claeys WL, Verraes C, Cardoen S, De Block J, Huyghebaert A, Raes K, Dewettinck K, Herman K: Потребление сырого или нагретого молока различных видов: оценка питательной ценности и потенциальной пользы для здоровья . Контроль пищевых продуктов. 2014; 42: 188–201.

  • 7.

    Cook HW, Baker BE. Уплотнительное молоко. I. Молоко гренландского тюленя ( Pagophilus groenlandicus ): состав и содержание остатков пестицидов.Может J Zool. 1969; 47: 1129–32.

    CAS PubMed Статья Google Scholar

  • 8.

    Cook HW, Rausch RA, Baker BE. Moose ( Alces alces ) молоко. Общий состав, жирные кислоты и минеральный состав. Может J Zool. 1970; 48: 213–5.

    CAS PubMed Статья Google Scholar

  • 9.

    De Waal HO, Osthoff WG, Hugo A, Myburgh J, Botes P. Состав молока африканского льва ( Panthera leo ), собранного через несколько дней после родов.Mammal Biol. 2004. 69: 375–83.

    Google Scholar

  • 10.

    Досако С., Танея С., Кимура Т., Омори Т., Дайкоку Х, Сузуки Н., Сава Дж., Кано К., Катаяма С. Молоко северного морского котика: состав, особенно углеводный и белковый. J Dairy Sci. 1983; 66: 2076–83.

  • 11.

    Фарли С.Д., Роббинс Коннектикут. Лактация, спячка и массовая динамика американских черных медведей и медведей гризли. Может J Zool. 1995; 73: 2216–22.

    Артикул Google Scholar

  • 12.

    Fox PF, McSweeney PLH. Молочная химия и биохимия. Нью-Йорк: Чепмен и Холл; 1998.

    Google Scholar

  • 13.

    Францманн А.В., Флинн А., Арнесон П.Д. Уровни и отношения элементов лося молока и волос. J Wildl Dis. 1976; 12: 202–7.

    CAS PubMed Статья Google Scholar

  • 14.

    Goto K, Fukuda K, Senda A, Saito T., Kimura K, Glander KE, Hinde K, Dittus W., Milligan LA, Power ML, Oftedal OT, Urashima T. Химическая характеристика олигосахаридов в молоке шесть видов обезьян Нового и Старого Света.Glycoconj J. 2010; 27: 703–15.

  • 15.

    Грин Б., Краузе В.Дж., Ньюгрейн К. Состав молока североамериканского опоссума ( Didelphis virginiana ). Comp Biochem Physiol B. 1996; 113: 619–23.

    CAS PubMed Статья Google Scholar

  • 16.

    Грегори М.Э., Кон С.К., Роуленд С.Дж., Томпсон С.И. Состав молока синего кита. J Dairy Res. 1955; 22: 108–12.

    CAS Статья Google Scholar

  • 17.

    Гросс Р., Боллигер А. Состав молока сумчатого trichosurus vulpecula. AMA J Dis Child. 1959; 98: 102–9.

    Google Scholar

  • 18.

    Hedberg GE, Derocher AE, Andersen M, Rogers QR, DePeters EJ, Lönnerdal B, et al. Состав молока белых медведей на свободном выгуле ( Ursus maritimus ) как модель молочной смеси при выращивании в неволе. Zoo Biol. 2011; 30: 550–65.

    CAS PubMed Статья Google Scholar

  • 19.

    Jenness R, Odell DK. Состав молока карликового кашалота ( Kogia Breviceps ). Comp Biochem Physiol A. 1978; 61: 383–6.

    Артикул Google Scholar

  • 20.

    Дженнесс Р. Сравнительные аспекты молочного белка. J Dairy Res. 1979; 46: 197–210.

    CAS PubMed Статья Google Scholar

  • 21.

    Jenness R, Holt C. Концентрации казеина и лактозы в молоке 31 вида имеют отрицательную корреляцию.Experientia. 1987. 43: 1015–8.

    CAS PubMed Статья Google Scholar

  • 22.

    Дженнесс Р., Слоан Р. Состав молока разных видов: обзор. Dairy Sci Abstr. 1970; 32: 599–612.

    Google Scholar

  • 23.

    Дженнесс Р. Биосинтез и соединения молока. J Invest Dermatol. 1974; 63: 109–18.

    CAS PubMed Статья Google Scholar

  • 24.

    Дженнесс Р. Лактационная способность различных видов млекопитающих. J Dairy Sci. 1986; 69: 869–85.

    CAS PubMed Статья Google Scholar

  • 25.

    Knight CH, Maltz E, Docherty AH. Надой и состав молока у мышей: влияние размера помета и количества лактации. Comp Biochem Physiol A. 1986; 84: 127–33.

    CAS PubMed Статья Google Scholar

  • 26.

    Корин С., Арад З. Изменения в составе молока египетских летучих мышей Rousettus Aegyptiacus ( Pteropodidae ) во время лактации. J Mammal. 1999; 80: 53–9.

    Артикул Google Scholar

  • 27.

    Кунц Т.Х., Стэк М.Х., Дженнесс Р. Сравнение состава молока у Myotis lucifugus и Eptesicus fuscus ( Chiropters: Vespertilionidae ). Биол Репрод. 1983; 28: 229–34.

    CAS PubMed Статья Google Scholar

  • 28.

    Kunz C, Lönnerdal B. Белковый состав молока макаки-резуса: сравнение с грудным молоком. Comp Biochem Physiol A. 1993; 104: 793-7.

    CAS Статья Google Scholar

  • 29.

    Кунц Т.Х., Офтедал О.Т., Робсон С.К., Крецманн М.Б., Кирк С. Изменения в составе молока во время лактации у трех видов насекомоядных летучих мышей. J. Comp Physiol B. 1995; 164: 543–51.

    CAS PubMed Статья Google Scholar

  • 30.

    Kuy S, Kelly VC, Smit AM, Palmer DJ, Cooper GJ. Протеомный анализ белков сыворотки и казеина в раннем молоке сумчатого Trichosurus vulpecula, обыкновенного опоссума щеткохвостого. Comp Biochem Physiol D. 2007; 2: 112–20.

    Google Scholar

  • 31.

    Lauer BH, Baker BE. Китовое молоко. I. Молоко финвата ( Balaenoptera Physalus ) и белухи ( Delphinapterus leucas ): общий состав и жирнокислотный состав.Может J Zool. 1969; 47: 95–7.

    CAS PubMed Статья Google Scholar

  • 32.

    Лауэр Б.Х., Кайт Э., Бейкер Б.Е. Волчье молоко. I. Арктический волк (Canis lupus arctos) и молоко хаски: общий состав и жирнокислотный состав. Может J Zool. 1969; 47: 99–102.

    CAS PubMed Статья Google Scholar

  • 33.

    Лауэр Б.Х., Блад Д.А., Пирсон А.М., Бейкер Б.Е. Козье молоко.I. Молоко горной козы ( Oreamnos americanus ). Валовой состав и жирнокислотный состав. Может J Zool. 1969; 47: 5–8.

    CAS PubMed Статья Google Scholar

  • 34.

    Lönnerdal B, Keen CL, Glazier CE, Anderson J. Продольное исследование состава молока макаки-резуса ( Macaca mulatta ): микроэлементы, минералы, белок, углеводы и жиры. Pediatr Res. 1984; 18: 911–4.

    PubMed Статья Google Scholar

  • 35.

    Медхаммар Э., Видесинья-Беттони Р., Штадлмайр Б., Нильссон Э, Шаррондьер У. Р., Бурлингейм Б. Состав молока мелких молочных животных и пород буйволов: перспектива биоразнообразия. J Sci Food Agric. 2012; 92: 445–74.

    CAS PubMed Статья Google Scholar

  • 36.

    Мефам ТБ, Бек Н.Ф. Изменение удоя и состава молока на протяжении лактации у морских свинок ( Cavia porcellus ). Comp Biochem Physiol A.1973; 45: 273–81.

    CAS PubMed Статья Google Scholar

  • 37.

    Морин Д.Е., Роуэн Л.Л., Херли В.Л., Бразелтон В.Е. Состав молока от лам в США. J Dairy Sci. 1995; 78: 1713–20.

    CAS PubMed Статья Google Scholar

  • 38.

    Накамура Т., Урасима Т., Мизуками Т., Фукусима М., Араи И., Сеншу Т., Имадзу К., Накао Т., Сайто Т., Йе З, Зуо Х., Ву К.: Состав и олигосахариды образца молока гигантская панда, Ailuropoda melanoleuca.Comp Biochem Physiol B. 2003; 135: 439–48.

  • 39.

    Нельсон В.Л., Кей А., Мур М., Уильямс Х.Х., Херрингтон Б.Л. Техника доения и состав молока морской свинки. J Nutr. 1951; 44: 585–94.

    CAS PubMed Google Scholar

  • 40.

    Невилл М., Уоттерс ЦД. Секреция кальция в молоко: обзор. J Dairy Sci. 1983; 66: 371–80.

    CAS PubMed Статья Google Scholar

  • 41.

    Никсон С.М., Харпер В.Дж. Состав молока серой белки. Ohio J Sci. 1972; 72: 3–6.

    CAS Google Scholar

  • 42.

    Oftedal OT. Адаптация секреции молока к ограничениям голодания у медведей, тюленей и усатых китов. J Dairy Sci. 1993; 76: 3234–46.

    CAS PubMed Статья Google Scholar

  • 43.

    Oftedal OT, Alt GL, Widdowson EM, Jakubasz MR.Питание и рост грудных черных медведей ( Ursus americanus ) во время зимнего голодания их матерей. Br J Nutr. 1993; 70: 59–79.

    CAS PubMed Статья Google Scholar

  • 44.

    Oftedal OT, Eisert R, Barrell GK. Сравнение аналитических и прогнозных методов для воды, белка, жира, сахара и валовой энергии в молоке морских млекопитающих. J Dairy Sci. 2014; 97: 4713–32.

    CAS PubMed Статья Google Scholar

  • 45.

    Osthoff G, de Wit M, Hugo A, Kamara BI. Молочный состав трех коров африканского слона ( Loxodonta africana africana ), находящихся на свободном выгуле, в середине лактации. Comp Biochem Physiol B. 2007; 148: 1–5.

    CAS PubMed Статья Google Scholar

  • 46.

    Osthoff G, Hugo A, de Wit M, Nguyen TP, Seier J. Состав молока верветной обезьяны (Chlorocebus pygerythrus) и макаки-резуса ( Macaca mulatta ) с наблюдениями за гориллами ( Gorilla gorilla gorilla) ) и белорукий гиббон ​​( Hylobates lar ).Comp Biochem Physiol B. 2009; 152: 332–8.

    CAS PubMed Статья Google Scholar

  • 47.

    Остхофф Г., Хьюго А., де Вит М. Сравнение состава молока свободно обитающих канн, куду, эмсбока и ятагана орикса с наблюдениями за лечве, окапи и южным пуду. Южная Африка J Wildlife Res. 2012; 42: 23–34.

    Артикул Google Scholar

  • 48.

    Park YW, Haenlein GFW.Справочник по молоку небычьих млекопитающих. Оксфорд: издательство Blackwell Publishing; 2006.

    Книга. Google Scholar

  • 49.

    Peddemors VM, de Muelenaere HJ, Devchand K. Сравнительный состав молока афалин ( Tursiops truncatus ), горбатого дельфина ( Sousa plumbea ) и обыкновенного дельфина ( Delphis ) из африканского дельфина воды. Comp Biochem Physiol A. 1989; 94: 639–41.

    CAS PubMed Статья Google Scholar

  • 50.

    Riet-Sapriza FG, Duignan PJ, Chilvers BL, Wilkinson IS, Lopez-Villalobos N, Mackenzie DDS, Macgibbon A, Costa DP, Gales N: Межгодовые и индивидуальные вариации в составе молока новозеландских морских львов ( Phocarctos hookeri ) . J Mammal. 2012; 93: 1006–16.

  • 51.

    Schryver HF, Oftedal OT, Williams J, Cymbaluk NF, Antczak D, Hintz HF. Сравнение минерального состава молока домашних и содержащихся в неволе диких непарнокопытных ( Equus przewalski, E. zebra, E. burchelli, E.caballus, E. assinus ). Comp Biochem Physiol A. 1986; 85: 233–5.

    CAS PubMed Статья Google Scholar

  • 52.

    Селваджи М., Лаудадио В., Дарио С., Туфарелли В. Основные белки козьего молока: обновленный обзор генетической изменчивости. Mol Biol Rep. 2014; 41: 1035–48.

    CAS PubMed Статья Google Scholar

  • 53.

    Соулс Л.К., Смит В.Р., Дженнесс Р., Слоан Р.Э., Регер Э.Химический состав и физические свойства молока пекари ошейникового. J Mammal. 1961; 42: 245–51.

    CAS Статья Google Scholar

  • 54.

    Стюарт REA, Webb BE, Lavigne DM, Fletcher F. Определение содержания лактозы в молоке гренландского тюленя. Может J Zool. 1983; 61: 1094–100.

    CAS Статья Google Scholar

  • 55.

    Tenner JS. Валовой состав овцебычьего молока.Может J Zool. 1956; 34: 569–71.

    Артикул Google Scholar

  • 56.

    Трилмих Ф., Лехнер Э. Молоко галапагосского морского котика и морского льва по сравнению с молоком ушастых тюленей ( Otariidae ). Дж. Зоол Лондон (A). 1986; 209: 271–7.

    Артикул Google Scholar

  • 57.

    Урасима Т., Кусака Ю., Накамура Т., Сайто Т., Маеда Н., Мессер М. Химическая характеристика молочных олигосахаридов бурого медведя, Ursus arctos yesoensis.Biochim Biophys Acta. 1997; 1334: 247–55.

    CAS PubMed Статья Google Scholar

  • 58.

    Урасима Т., Сайто Т., Накамура Т., Мессер М. Олигосахариды молока и молозива у млекопитающих, кроме человека. Glycoconj J. 2001; 18: 357–71.

    CAS PubMed Статья Google Scholar

  • 59.

    Wamberg S, Tauson AH. Суточное потребление молока и водооборот тела молочных норок ( Mustela vison ).Comp Biochem Physiol A. 1998; 119: 931-9.

    CAS Статья Google Scholar

  • 60.

    Уиддоусон Э.М. Молоко и новорожденное животное. Proc Nutr Soc. 1984. 43: 87–100.

    CAS PubMed Статья Google Scholar

  • 61.

    Whittier CA, Milligan LA, Nutter FB, Cranfield MR, Power ML. Примерный состав молока вольных горных горилл ( Gorilla beringei beringei ).Zoo Biol. 2011; 30: 308–17.

    CAS PubMed Статья Google Scholar

  • 62.

    Zurowski W, Kisza J, Kruk A, Roskosz A. Лактация и химический состав молока европейского бобра ( Castor fiber L. ). J Mammal. 1974; 55: 847–50.

    CAS PubMed Статья Google Scholar

  • 63.

    Акерс РМ. Лактация и молочная железа. Эймс: Издательство государственного университета Айовы; 2002 г.

    Google Scholar

  • 64.

    Arendt LM, Kuperwasser C. Форма и функция: как эстроген и прогестерон регулируют иерархию эпителия молочной железы. J Mammary Gland Biol Neoplasia. 2015; 20: 9–25.

    PubMed Статья Google Scholar

  • 65.

    Блэкберн Д.Г., Хейсен В., Мерфи С.Дж. Истоки лактации и эволюция молока: обзор с новой гипотезой. Млекопитающее Rev.1989; 19: 1–26.

    Артикул Google Scholar

  • 66.

    Ким С.В., Ву Г. Регулирующая роль аминокислот в росте молочных желез и синтезе молока. Аминокислоты. 2009; 37: 89–95.

    CAS PubMed Статья Google Scholar

  • 67.

    Лей Дж, Фэн Д., Чжан И, Чжао Ф.К., Ву З., Сан-Габриэль А., Фудзишима Й, Унеяма Х, Ву Г.: Пищевая и регулирующая роль аминокислот с разветвленной цепью в период лактации.Передние биоски. 2012; 17: 2725–39.

  • 68.

    Лей Дж, Фэн Д., Чжан И, Даханаяка С., Ли Х, Яо К., Ван Дж, Ву З, Дай З, Ву Г: Регулирование катаболизма лейцина метаболическим топливом в эпителиальных клетках молочных желез. Аминокислоты. 2012; 43: 2179–89.

  • 69.

    Li P, Knabe DA, Kim SW, Lynch C, Hutson S, Wu G. В ткани молочной железы кормящей свиньи катаболизируются аминокислоты с разветвленной цепью для синтеза глутамина и аспарата. J Nutr. 2009; 139: 1502–9.

    CAS PubMed PubMed Central Статья Google Scholar

  • 70.

    Ву Г. Аминокислоты: биохимия и питание. Бока-Ратон: CRC Press; 2013.

    Книга Google Scholar

  • 71.

    Rezaei R, Knabe DA, Li XL, Feng S, Wu G. Повышенная эффективность использования молока для роста выживших маловесных поросят. J Anim Sci Biotech. 2011; 2: 73–83.

    Google Scholar

  • 72.

    Киниу Н., Дагорн Дж., Гаудре Д. Изменение веса поросят при рождении и их последствия для последующей продуктивности.Livest Prod Sci. 2002; 78: 63–70.

    Артикул Google Scholar

  • 73.

    Ву Г., Базер Ф.В., Уоллес Дж. М., Спенсер Т. Е.. Задержка внутриутробного развития: значение для зоотехники. J Anim Sci. 2006. 84: 2316–37.

    CAS PubMed Статья Google Scholar

  • 74.

    PigCHAMP. PigCHAMP 2008 Бенчмаркинг. Эймс: PigCHAMP Inc; 2008 г. Доступно: http: //www.pigchamp.ru / summary_archives.html. По состоянию на 10 января 2015 г.

    Google Scholar

  • 75.

    Уолтер Б.Ф., Эллис М., Корриган Б.П., Дедеккер Дж. Влияние веса при рождении и кормления дополнительным заменителем молока поросят во время лактации на показатели роста до и после отъема и характеристики туши. J Anim Sci. 2002; 80: 301–8.

    CAS PubMed Google Scholar

  • 76.

    Boyd DR, Kensinger RS, Harrell RJ, Bauman DE. Поглощение питательных веществ и эндокринная регуляция синтеза молока тканями молочной железы кормящих свиноматок. J Anim Sci. 1995. 73: 36–56.

    Google Scholar

  • 77.

    Wu G, Knabe DA, Kim SW. Аргининовое питание новорожденных свиней. J Nutr. 2004; 134: 2783С – 90.

    CAS PubMed Google Scholar

  • 78.

    Wu G, Bazer FW, Johnson GA, Knabe DA, Burghardt RC, Spencer TE, Li X, Wang J: Важные роли L-глутамина в кормлении и производстве свиней.J Anim Sci. 2011; 89: 2017–30.

  • 79.

    Manjarin R, Bequette BJ, Wu G, Trottier NL. Связывание нашего понимания метаболизма молочных желез с аминокислотным питанием. Аминокислоты. 2014; 46: 2447–62.

    CAS PubMed Статья Google Scholar

  • 80.

    Троттье Н.Л., Шипли, округ Колумбия, Истер, РА. Поглощение аминокислот в плазме молочной железы кормящей свиноматки. J Anim Sci. 1997; 75: 1266–78.

    CAS PubMed Google Scholar

  • 81.

    DeSantiago S, Torres N, Hutson S, Tovar AR. Индукция экспрессии аминотрансферазы с разветвленной цепью и дегидрогеназы альфа-кетокислоты в тканях крыс во время лактации. Adv Exp Med Biol. 2001; 501: 93–9.

    CAS PubMed Статья Google Scholar

  • 82.

    Ву Г., Кнабе Д.А. Свободные и связанные с белком аминокислоты в молозиве и молоке свиноматки. J Nutr. 1994; 124: 415–24.

    CAS PubMed Google Scholar

  • 83.

    О’Куинн П.Р., Кнабе Д.А., Ву Г. Катаболизм аргинина в ткани молочной железы кормящей свиньи. J Anim Sci. 2002; 80: 467–74.

    PubMed Google Scholar

  • 84.

    Кроули WR. Нейроэндокринная регуляция лактации и производства молока. Comp Physiol. 2015; 5: 255–91.

    Google Scholar

  • 85.

    Hartmann PE, Whitely JL, Willcox DL. Лактоза в плазме во время лактогенеза, установленного периода лактации и отъема у свиноматок.J Physiol. 1984; 347: 453–63.

    CAS PubMed PubMed Central Статья Google Scholar

  • 86.

    Musumeci G, Castrogiovanni P, Szychlinska MA, Aiello FC, Vecchio GM, Salvatorelli L, et al. Молочная железа: от эмбриогенеза до взрослой жизни. Acta Histoche. 2015; 117: 379–85.

    CAS Статья Google Scholar

  • 87.

    Инман Дж. Л., Робертсон К., Мотт Дж. Д., Бисселл М. Дж..Развитие молочной железы: спецификация клеточной судьбы, стволовые клетки и микросреда. Разработка. 2015; 142: 1028–42.

    CAS PubMed Статья Google Scholar

  • 88.

    van Nieuwamerongen SE, Bolhuis JE, van der Peet-Schwering CM, Soede NM. Обзор поведения и продуктивности свиноматок и поросят в системах группового содержания для кормящих свиноматок. Животное. 2014; 8: 448–60.

    PubMed Статья Google Scholar

  • 89.

    Accorsi PA, Pacioni B, Pezzi C, Forni M. Роль пролактина, гормона роста и инсулиноподобного фактора роста 1 в инволюции молочной железы у дойной коровы. J Dairy Sci. 2002; 85: 507–13.

    CAS PubMed Статья Google Scholar

  • 90.

    Манавати Б., Самантапуди В.С., Гаджулапалли В.Н. Корегуляторы эстрогеновых рецепторов и первооткрыватели: организаторы судьбы и развития клеток молочной железы. Front Cell Dev Biol.2014; 2: 34.

    PubMed PubMed Central Статья Google Scholar

  • 91.

    Cheng G, Weihua Z, Warner M, Gustafsson JA. Рецепторы эстрогенов Er альфа и Er бета при пролиферации в молочной железе грызунов. Proc Natl Acad Sci USA. 2004. 101: 3739–46.

    CAS PubMed PubMed Central Статья Google Scholar

  • 92.

    Etherton TD, Bauman DE. Биология соматотропина в росте и лактации домашних животных.Dom Anim Endocrinol. 1998. 17: 101–16.

    Google Scholar

  • 93.

    Сейрсен К., Пуруп С., Вестергаард М., Вебер М.С., Найт Ч. Гормон роста и развитие молочных желез. Dom Anim Endocrinol. 1999; 17: 117–29.

    CAS Статья Google Scholar

  • 94.

    Невилл М.С., Макфадден Т., Форсайт И. Гормональная регуляция дифференцировки молочных желез и секреции молока. J Mammary Gland Biol Neoplasia.2002; 7: 49–66.

    PubMed Статья Google Scholar

  • 95.

    Эллис С., Пуруп С., Сейрсен К., Акерс Р.М. Рост и морфогенез органоидов эпителиальных клеток периферической и медиальной паренхимы молочной железы у телок препубертатного возраста. J Dairy Sci. 2000. 5: 952–61.

    Артикул Google Scholar

  • 96.

    Фермер С., Палин М.Ф. Экзогенный пролактин стимулирует развитие молочных желез и изменяет экспрессию генов, связанных с пролактином, у свинок препубертатного возраста.J Anim Sci. 2005; 83: 825–32.

    CAS PubMed Google Scholar

  • 97.

    Бауман Д.Е., Вернон Р.Г. Влияние экзогенного соматотропина крупного рогатого скота на лактацию. Annu Rev Nutr. 1993; 13: 437–61.

    CAS PubMed Статья Google Scholar

  • 98.

    Tucker HA. Гормоны, рост молочных желез и лактация: 41-летняя перспектива. J Dairy Sci. 2000. 83: 874–84.

    CAS PubMed Статья Google Scholar

  • 99.

    Kensinger RS, Collier RJ, Bazer FW. Ультраструктурные изменения ткани молочной железы свиней при лактогенезе. J Anat. 1986; 145: 49–59.

    CAS PubMed PubMed Central Google Scholar

  • 100.

    Барбер М.С., Клегг Р.А., Финли Э., Вернон Р.Г., Флинт Д.И. Роль гормона роста, пролактина и инсулиноподобных факторов роста в регуляции метаболизма молочной железы и жировой ткани крыс во время лактации. J Endocrinol. 1992; 135: 195–202.

    CAS PubMed Статья Google Scholar

  • 101.

    Hayden TJ, Thomas CR, Smith SV, Forsyth A. Плацентарный лактоген у козы в зависимости от стадии беременности, количества плодов, метаболитов, прогестерона и времени суток. J Endocr. 1980; 86: 279–80.

    CAS PubMed Статья Google Scholar

  • 102.

    Hurley WL. Рост молочной железы у кормящей свиноматки.Livest Prod Sci. 2001; 70: 149–57.

    Артикул Google Scholar

  • 103.

    Пер М.С., Этьен М. Чувствительность к инсулину во время беременности, кормления грудью и после отъема у первородящих свинок. J Anim Sci. 2007; 85: 101–10.

    PubMed Статья CAS Google Scholar

  • 104.

    Wu G, Bazer FW, Johnson GA, Knabe DA, Burghardt RC, Spencer TE, Li X, Wang J: Уровни пролактина и инсулина у кормящих свиноматок в зависимости от частоты кормления.Dom Anim Endocrinol. 1999; 17: 53–64.

  • 105.

    Ким С.В., Херли В.Л., Хан И.К., Истер РА. Изменения тканевого состава, связанные с ростом молочной железы у свиноматок во время лактации. J Anim Sci. 1999; 77: 2510–6.

    CAS PubMed Google Scholar

  • 106.

    Hovey RC, McFadden TB, Akers RM. Регуляция роста и морфогенеза молочной железы жировой подушечкой молочной железы: сравнение видов. J Mammary Gland Biol Neoplasia.1999; 4: 53–68.

    CAS PubMed Статья Google Scholar

  • 107.

    Plath-Gabler A, Gabler C, Sinowatz F, Berisha B, Schams D. Экспрессия семейства IGF и рецептора GH в молочной железе крупного рогатого скота. J Endocrinol. 2001. 168: 39–48.

    CAS PubMed Статья Google Scholar

  • 108.

    Kim SW, Easter RA, Hurley WL. Регрессия необъятых молочных желез во время лактации у свиноматок: влияние стадии лактации, пищевых питательных веществ и размера помета.J Anim Sci. 2001. 79: 2659–68.

    CAS PubMed Google Scholar

  • 109.

    Люси М.С. Функциональные различия в оси гормона роста и инсулиноподобного фактора роста у крупного рогатого скота и свиней: последствия для послеродового питания и воспроизводства. Reprod Dom Anim. 2008; 43 (Дополнение 2): 31–9.

  • 110.

    Шеннан Д., Пикер М. Транспорт компонентов молока молочной железой. Physiol Rev.2000; 80: 925–51.

    CAS PubMed Google Scholar

  • 111.

    Галлахер Д.П., Коттер П.Ф., Малвихилл DM. Белки свиного молока: обзор. Int Dairy J. 1997; 7: 99–118.

    CAS Статья Google Scholar

  • 112.

    Dahanayaka S, Rezaei R, Porter WW, Johnson GA, Burghardt RC, Bazer FW, Hou YQ, Wu ZL, Wu G: Техническое примечание: Выделение и характеристика эпителиальных клеток молочной железы свиней. J Anim Sci. 2015; 93: 5186–93.

  • 113.

    Rezaei R, Wang WW, Wu ZL, Dai ZL, Wang JJ, Wu G.Биохимические и физиологические основы использования пищевых аминокислот молодыми свиньями. J Anim Sci Biotechnol. 2013; 4: 7.

    CAS PubMed PubMed Central Статья Google Scholar

  • 114.

    Hurley WL. Состав молозива свиноматки и молока. В: Фермер С., редактор. Беременная и кормящая свиноматка. Вагенинген: академические издательства Вагенингена; 2015. с. 193–229.

    Google Scholar

  • 115.

    Колумбус Д.А., Фиоротто М.Л., Дэвис Т.А. Лейцин является основным регулятором синтеза мышечного белка у новорожденных. Аминокислоты. 2015; 47: 259–70.

    CAS PubMed PubMed Central Статья Google Scholar

  • 116.

    Wang H, Ji Y, Wu G, Sun KJ, Sun YL, Li W, Wang B, He BB, Zhang Q, Dai ZL, Wu ZL: L-триптофан активирует мишень рапамицина у млекопитающих и усиливает экспрессию белков плотного соединения в эпителиальных клетках кишечника свиней.J Nutr. 2015; 145: 1156–62.

  • 117.

    Ван Б., Ву Г., Чжоу З. Г., Дай З.Л., Сунь Ю.Л., Чжан С., Цзяо Н., Цзи Ю., Ли В., Ван В.В., Ву З.Л .: Глютамин и функция кишечного барьера. Аминокислоты. 2015; 47: 2143–54.

  • 118.

    Wang WW, Wu ZL, Lin G, Hu SD, Wang B, Dai ZL, Wu G: Глицин стимулирует синтез белка и подавляет окислительный стресс в эпителиальных клетках тонкого кишечника свиней. J Nutr. 2014; 144: 1540–8.

  • 119.

    Wang WW, Dai ZL, Wu ZL, Lin G, Jia SC, Hu SD, Dahanayaka S, Wu G: Глицин является незаменимой аминокислотой для максимального роста молодых свиней, выкармливаемых молоком.Аминокислоты. 2014; 46: 2037–45.

  • 120.

    Wang WW, Wu ZL, Dai ZL, Yang Y, Wang JJ, Wu G. Метаболизм глицина у животных и людей: последствия для питания и здоровья. Аминокислоты. 2013; 45: 463–77.

    PubMed Статья CAS Google Scholar

  • 121.

    Tan BE, Xiao H, Xiong X, Wang J, Li GR, Yin YL, Huang B, Hou YQ, Wu G: L-аргинин улучшает синтез ДНК в энтероцитах, вызванных LPS. Передние биоски. 2015; 20: 989–1003.

  • 122.

    Суряван А., Дэвис Т.А. Регуляция синтеза белка аминокислотами в мышцах новорожденных. Передние биоски. 2011; 16: 1445–60.

    CAS Статья Google Scholar

  • 123.

    Appuhamy JA, Knoebel NA, Nayananjalie WD, Escobar J, Hanigan M. Изолейцин и лейцин независимо регулируют передачу сигналов mTOR и синтез белка в клетках MAC-T и срезах ткани молочной железы крупного рогатого скота. J Nutr. 2012; 142: 484–91.

    CAS PubMed Статья Google Scholar

  • 124.

    Wang L, Lin Y, Bian Y, Liu L, Shao L, Lin L, Qu B, Zhao F, Gao X, Li Q: лейцил-тРНК-синтетаза регулирует лактацию и пролиферацию клеток посредством передачи сигналов mTOR в эпителиальных клетках молочной железы дойных коров. Int J Mol Sc. 2014; 15: 5952–69.

  • 125.

    Арриола Апело С.И., Зингер Л.М., Линь XY, МакГиллиард М.Л., Сен-Пьер Н.Р., Ханиган Мэриленд. Изолейцин, лейцин, метионин и треонин воздействуют на млекопитающих, являющихся мишенью передачи сигналов рапамицина в ткани молочной железы. J Dairy Sci. 2014; 97: 1047–56.

    CAS PubMed Статья Google Scholar

  • 126.

    Бекетт Б.Дж., Бэквелл, Франция, Кромптон, Лос-Анджелес. Современные представления об обмене аминокислот и белков в молочной железе кормящих жвачных животных. J Dairy Sci. 1998. 81: 2540–59.

    CAS PubMed Статья Google Scholar

  • 127.

    Mateo RD, Wu G, Moon HK, Carroll JA, Kim SW. Влияние добавок аргинина в рацион во время беременности и кормления грудью на продуктивность кормящих первородящих свиноматок и кормящих поросят. J Anim Sci.2008. 86: 827–35.

    CAS PubMed Статья Google Scholar

  • 128.

    Richert BT, Goodband RD, Tokach MD, Nelssen JL. Увеличение количества валина, изолейцина и общего количества аминокислот с разветвленной цепью для кормящих свиноматок. J Anim Sci. 1997; 75: 2117-28.

    CAS PubMed Google Scholar

  • 129.

    Richert BT, Tokach MD, Goodband RD, Nelssen JL, Campbell RG, Kershaw S.Влияние диетического лизина и валина, скармливаемого во время лактации, на продуктивность свиноматок и подстилки. J Anim Sci. 1997; 75: 1853–60.

    CAS PubMed Google Scholar

  • 130.

    Richert BT, Tokach MD, Goodband RD, Nelssen JL, Pettigrew JE, Walker RD, Johnston LJ: Потребность в валине высокопродуктивных лактирующих свиноматок. J Anim Sci. 1997; 74: 1307–13.

  • 131.

    Moser SA, Tokach MD, Dritz SS, Goodband RD, Nelssen JL, Loughmiller JA.Влияние аминокислот с разветвленной цепью на продуктивность свиноматок и подстилки. J Anim Sci. 2000. 78: 658–67.

    CAS PubMed Google Scholar

  • 132.

    Paulicks BR, Ott H, Roth-Maier DA. Показатели кормящих свиноматок в ответ на поступление валина в рацион. J Anim Physiol Anim Nutr. 2003. 87: 389–96.

    CAS Статья Google Scholar

  • 133.

    Wu G, Bazer FW, Dai ZL, Li DF, Wang JJ, Wu ZL.Аминокислотное питание животных: синтез белка и не только. Анну Rev Anim Biosci. 2014; 2: 387–417.

    CAS PubMed Статья Google Scholar

  • 134.

    Рулкин Х., Писулевски П. Влияние ступенчатых уровней дуоденальных инфузий лейцина на поглощение и выработку молочными железами у лактирующих молочных коров. J Dairy Res. 2006. 73: 328–39.

    CAS PubMed Статья Google Scholar

  • 135.

    Дьюи КГ. Стресс матери и плода связан с нарушением лактогенеза у человека. J Nutr. 2001; 131: 3012С – 5.

  • 136.

    Brown EG, Vandehaar MJ, Daniels KM, Liesman JS, Chapin LT, Keisler DH, Nielsen MS: Влияние увеличения потребления энергии и белка на рост тела и состав туши телят. J Dairy Sci. 2005; 2005 (88): 585–94.

  • 137.

    Wu G, Fanzo J, Miller DD, Pingali P, Post M, Steiner JL, Thalacker-Mercer AE: Производство и поставка высококачественного пищевого белка для потребления человеком: устойчивость, проблемы и инновации.Ann NY Acad Sci. 2014; 1321: 1–19.

  • 138.

    Wu G, Bazer FW, Cross HR. Производство животного белка на суше: влияние, эффективность и устойчивость. Ann NY Acad Sci. 2014; 1328: 18–28.

    PubMed Статья Google Scholar

  • 139.

    Hou YQ, Yin YL, Wu G. Необходимость в питании «незаменимых в питательном отношении аминокислот» для животных и людей. Exp Biol Med. 2015; 240: 997–1007.

    CAS Статья Google Scholar

  • 140.

    Sun YL, Wu ZL, Li W, Zhang C, Sun KJ, Ji Y, Wang B, Jiao N, He BB, Wang WW, Dai ZL, Wu G: диетические добавки L-лейцина улучшают развитие кишечника у поросят-сосунков. Аминокислоты. 2015; 47: 1517–25.

  • 141.

    Ву Г. Диетические потребности животных в синтезируемых аминокислотах: изменение парадигмы белкового питания. J Anim Sci Biotechnol. 2014; 5: 34.

    PubMed PubMed Central Статья CAS Google Scholar

  • Каковы преимущества аминокислот в росте?

    Нут разложен на белом прилавке.

    Изображение предоставлено: Галайко Сергей / iStock / Getty Images

    Аминокислоты являются строительными блоками белка и важны для многих механизмов организма. Их также можно рассматривать как строительные блоки костей, тканей, суставов и кожи. Некоторые аминокислоты важны для правильного роста и роста веса; В частности, L-аргинин, L-лизин и L-орнитин связаны с ускорением роста в организме.

    Хотя некоторые аминокислоты стимулируют гормон роста человека, имеется мало доказательств того, что они могут стимулировать рост или увеличение мышц у взрослых.Проконсультируйтесь с врачом, чтобы определить потребность в добавках аминокислот для детей или взрослых.

    L-аргинин

    В книге «Лечебные питательные вещества внутри: факты, открытия и новые исследования аминокислот» авторы Эрик Р. Браверман, Карл Курт Пфайффер, Кеннет Блюм и Ричард Смайда обсуждают результаты исследований о том, что L-аргинин выделяет гормон роста. у детей невысокого роста. Они отмечают, что это действие происходит через аминокислоты, стимулирующие рост костной и хрящевой систем и удержание аминокислот, составляющих белок, наряду с высвобождением жирных кислот из тканей.L-аргинин содержится в орехах, мясе, морепродуктах, соевых бобах, нуте и шоколаде.

    Не принимайте L-аргинин, если не работаете в тесном сотрудничестве с вашим лечащим врачом.

    L-лизин

    Незаменимая аминокислота L-лизин также играет ключевую роль в росте. На веб-сайте Медицинского центра Университета Мэриленда отмечается, что лизин, помогая организму усваивать кальций и являясь сложной частью образования коллагена, обнаруженного в костях, коже, сухожилиях и хрящах, способствует правильному росту.Лизин содержится в продуктах с высоким содержанием белка, таких как мясо, бобы, орехи, яйца и спирулина.

    Следует отметить, что высокий уровень аргинина в организме может снизить уровень лизина, поскольку они имеют общие пути в организме. Прежде чем добавлять лизин в свой режим, проконсультируйтесь с практикующим врачом, который понимает влияние добавок аминокислот.

    L-орнитин

    L-орнитин также может быть полезен, когда речь идет о росте в организме. Филлис Балч в своей книге «Рецепт лечебного питания» отмечает, что орнитин способствует высвобождению гормона роста.Аргинин иногда превращается в орнитин в организме, и, согласно «Исцеляющим питательным веществам внутри» Эрика Бравермана, может быть разумнее принимать добавки напрямую с орнитином, так как он усваивается легче, чем аргинин.

    Проконсультируйтесь с опытным практикующим перед добавлением орнитина.

    Как незаменимые аминокислоты улучшают качество протеина

    Известно, что потребление белка важно для роста и развития мышц среди активных взрослых и спортсменов. Что улучшает качество протеина, делая его более эффективным для синтеза мышечного протеина (MPS), так это присутствие аминокислот.Как растения, так и источники пищи животного происхождения содержат белок, но различаются по типу и соотношению аминокислот.

    Белки и аминокислоты

    Аминокислоты являются строительными блоками белка и помогают определять его качество. Всего существует 20 аминокислот, состоящих из девяти незаменимых аминокислот (EAA) и 11 заменимых аминокислот (NEAA). Организму нужны все 20, но EAA не могут вырабатываться организмом и должны поступать из пищи, которую мы едим.

    Незаменимые аминокислоты, полученные из нашего рациона, включают метионин, валин, лейцин, изолейцин, треонин, лизин, триптофан и фенилаланин.Гистидин включен в качестве дополнительной незаменимой аминокислоты, необходимой для развития в раннем детстве.

    Ниже описывается функция каждой незаменимой аминокислоты:

    • Метионин - серосодержащая аминокислота, отвечающая за рост и восстановление тканей. Эта аминокислота также поддерживает волосы, кожу и прочность ногтей. Кроме того, метионин отвечает за защиту организма от загрязняющих веществ, замедляет старение клеток и необходим для абсорбции и биодоступности цинка и селена.
    • Валин - предотвращает разрушение мышц во время упражнений, поддерживает повседневную функцию организма, метаболизм мышц, рост, обмен веществ, помогает нервной системе, включая когнитивные функции, и поддерживает баланс азота. Часть группы аминокислот с разветвленной цепью (BCAA).
    • Лейцин - Стимулирует рост и силу мышц, регулирует уровень сахара в крови, способствует выработке гормона роста и помогает заживлению ран. Считается «основной» аминокислотой с разветвленной цепью (BCAA), ответственной за синтез мышечного белка.
    • Изо-лейцин - форма лейцина, которая способствует выработке энергии, способствует заживлению ран, выводит токсины из азота, стимулирует иммунную функцию, необходима для образования гемоглобина и помогает регулировать уровень сахара в крови. Часть группы аминокислот с разветвленной цепью (BCAA).
    • Треонин - Помогает поддерживать структуру зубной эмали, коллагена и эластина. Эта аминокислота также жизненно важна для нервной системы, метаболизма жиров и предотвращения накопления жира в печени.Кроме того, эта аминокислота может уменьшить беспокойство и легкую депрессию.
    • Лизин — Поддерживает надлежащий уровень карнитина, который помогает снизить уровень холестерина. Требуется для роста и восстановления тканей. Также отвечает за поддержку иммунной системы, усвоение кальция и выработку карнитина и коллагена.
    • Триптофан - действует как нейротрансмиттер, регулирует определенные гормоны и способствует здоровью нервной системы и мозга. Это предшественник серотонина. Серотинин отвечает за регулирование сна, аппетита, настроения и боли.
    • Фенилаланин - отвечает за структуру и функцию многих белков и ферментов. Преобразуется в тирозин, который отвечает за дофамин и норэпинефрин (нейромедиатор).
    • Гистидин - полузаменимая аминокислота. Помогает в развитии и поддержании здоровья тканей тела и нервной системы. Важен для детей и раннего развития детей. Также играет роль в иммунной системе, желудочной секреции и сексуальной функции.При формировании клеток крови гистидин защищает клетки от радиации и повреждений тяжелыми металлами.

    Белки из большинства источников пищи животного происхождения содержат все незаменимые аминокислоты (EAA) в нужных количествах. Их также называют полными белками. Пища из растительных источников, как правило, не имеет одной или нескольких незаменимых аминокислот, что создает неполный белок. Растительный белок ограничивает определенные аминокислоты, включая лизин, метионин и триптофан, что ограничивает функционирование белка в организме.

    Согласно исследованиям, белки животного и молочного происхождения содержат наибольшее количество EAA для синтеза белка и роста мышц после тренировки.

    Качество белка измеряется несколькими методами, в том числе:

    • Химическая оценка - Относится к аминокислотному профилю белка, и каждая аминокислота оценивается по сравнению с идеальным или эталонным белком.
    • Коэффициент эффективности белка - Первый метод, принятый для оценки качества белка в продуктах питания.Показатель прибавки в весе участника теста, разделенный на количество потребляемого пищевого белка в течение испытательного периода
    • Биологическая ценность - Показатель белка, который задерживается, а затем используется в организме.
    • Чистое использование белка (NPU) - соотношение аминокислот, используемых организмом, по сравнению с аминокислотами, которые содержатся в рационе.
    • Оценка аминокислот с поправкой на усвояемость белка (PDCAAS) - Считается предпочтительным лучшим методом для измерения качества белка; оценивает потребность в аминокислотах и ​​нашу способность их переваривать
    • Индикаторная методика окисления аминокислот (IAAO) - новейший успешный метод, используемый для определения метаболической доступности аминокислот из пищевых белков и общей потребности в белке

    В целом, качество белка означает, насколько он эффективен для стимуляции синтеза мышечного белка (MPS) и стимулирования роста мышц.Это беспокоит многих активных взрослых, спортсменов и людей, стремящихся к фитнесу, которые хотят получить максимум от своего потребления белка. Похоже, что аминокислотный профиль играет самую большую роль в потреблении качественного источника белка. Исследования также показывают, что есть три незаменимые аминокислоты, которые в первую очередь отвечают за регулирование белкового баланса.

    Три основных незаменимых аминокислоты для роста мышц

    Аминокислоты обеспечивают способность белка восстанавливать и восстанавливать скелетные мышцы и соединительные ткани.Хотя все незаменимые аминокислоты (EAA) важны для этой функции, три должны играть главную роль. ЕАА лейцин, изолейцин и валин однозначно идентифицированы для регулирования метаболизма белков, нервной функции, а также регуляции уровня глюкозы и инсулина в крови.

    В исследовании 2017 года с участием 11 здоровых мужчин лейцин, изолейцин и валин также являются аминокислотами с разветвленной цепью (BCAA), которые, как было показано, являются ключевыми компонентами синтеза мышечного белка (MPS). Очевидно, что BCAA быстро попадают в кровоток при пероральном приеме и обеспечивают мышечную ткань высокими концентрациями этих аминокислот для восстановления и роста мышц.Вот почему многие активные взрослые и спортсмены выбирают добавки с BCAA.

    Хотя были определены три основных незаменимых аминокислоты, похоже, что лейцин лучше для роста и силы мышц. Несколько исследований спортивного питания рекомендуют спортсменам потреблять достаточное количество лейцина из качественных источников белка при каждом приеме пищи, чтобы подавить повреждение мышц, помочь в восстановлении и активировать синтез белка.

    Журнал Международного общества спортивного питания предоставил следующие ключевые моменты по незаменимым аминокислотам (EAA) и качеству белка:

    • Источники протеина с более высоким содержанием незаменимых аминокислот считаются более качественными.
    • Организм использует 20 аминокислот для производства белков, но девять незаменимых аминокислот поступают только с пищей, которую мы едим для удовлетворения наших повседневных потребностей.
    • Незаменимые аминокислоты (EAA) ответственны за усиление синтеза мышечного белка в дозах от 6 до 15 граммов.
    • Дозы лейцина от 1 до 3 граммов на прием пищи, по-видимому, важны для стимуляции синтеза мышечного белка.
    • Аминокислоты с разветвленной цепью (BCAA), изолейцин, лейцин и валин, по-видимому, действуют по отдельности или вместе, чтобы стимулировать выработку белка для роста и восстановления мышц.
    • Хотя показано, что большие дозы только лейцина стимулируют рост мышц, установлено, что сбалансированное потребление всех незаменимых аминокислот (ЕАА) способствует наибольшему увеличению.
    • Употребление качественных источников белка в нужное время с адекватным уровнем лейцина / BCAA лучше всего будет способствовать увеличению синтеза мышечного белка (MPS).

    Сравнение источников белка

    Лучшие источники белка - это те, которые могут положительно повлиять на баланс белка при потреблении и стимулировать рост мышц вместе с потерей жира в долгосрочной перспективе.Кроме того, согласно исследованиям, также следует учитывать способность белка усиливать иммунную функцию и создавать антиоксидантную среду. Похоже, что для достижения этой цели и важных факторов при выборе белка является содержание лейцина и скорость его переваривания. Понимание того, как следующие источники протеина различаются по качеству и эффективности, поможет вам выбрать подходящий протеин:

    Молочные белки были широко изучены и показали, что они значительно улучшают восстановление мышц после тренировки.Они также являются отличным способом пополнить запасы гликогена и улучшить белковый баланс, чтобы стимулировать синтез мышечного белка (MPS). Белки молока также увеличивают скелетную и нервно-мышечную силу. Они обладают наибольшей плотностью содержания лейцина и наивысшим баллом по шкале аминокислот с поправкой на усвояемость белка (PDCAAS). Белки молока делятся на два класса:

    • Казеин - водорастворимый, с самым высоким содержанием лейцина, но гель в кишечнике замедляет скорость пищеварения.Медленное увеличение концентрации аминокислот, но остается повышенным в течение более длительного периода времени. Показано, что казеин стимулирует синтез и рост мышечного белка.
    • Whey - Водорастворимый, с самым высоким содержанием лейцина, легко и быстро усваивается. Постоянные исследования показывают, что более быстрое переваривание сывороточного протеина полезно для набора мышечной массы у бодибилдеров.

    Яичные белки считаются идеальным источником белка с аминокислотным профилем, который использовался в качестве стандарта для сравнения других пищевых белков.Яйца - это высококачественный источник белка, богатый лейцином. Они легко усваиваются, излюбленная белковая пища для спортсменов, и показано, что они значительно увеличивают синтез белка в мышечной ткани и в кровотоке. Яичный белок является экономичным и также считается функциональным продуктом питания для людей, склонных к фитнесу. Согласно исследованиям, функциональные продукты содержат профиль питательных веществ с пользой для здоровья, превышающей то, что обеспечивается основным питанием.

    Белки мяса хорошо известны как богатые источники незаменимых аминокислот (EAAs).Говядина содержит полный баланс EAA и, как считается, имеет высокую биологическую ценность. Белки мяса содержат высокую концентрацию лейцина, а 30 г говяжьего белка стимулируют синтез мышечного белка (MPS) как у молодых, так и у пожилых людей. Белки мяса также содержат качественные микроэлементы и минералы, включая железо, B12 и фолиевую кислоту. Исследования показывают, что белки мяса помогают увеличить мышечную массу и уменьшить жировую массу. Белки мяса также являются богатым источником молекулы карнитина, которая помогает уменьшить повреждение мышц, вызванное физическими упражнениями.

    Протеиновые смеси обычно представляют собой порошки, в которых сочетаются сывороточный и казеиновый протеины. Некоторые смеси также включают аминокислоты с разветвленной цепью (BCAA), глутамин и другие дополнительные питательные вещества. Исследования показывают, что сочетание источников белка может дать спортсменам дополнительные преимущества. Исследование силовых тренировок показало, что участники, потреблявшие смесь сыворотки и казеина, имели наибольший прирост мышечной массы за 10-недельный период. Подобные исследования, продолжавшиеся 12 недель, показали улучшение прироста силы и состава тела по сравнению с простым белком или комбинацией белок / калорий.Также было показано, что белковые смеси оказывают положительное и продолжительное влияние на аминокислотный баланс. Похоже, что белковые смеси могут быть полезными добавками для обеспечения адекватного потребления белка с пищей для роста мышц.

    Ниже приводится краткое изложение основанных на фактах ключевых моментов об источниках белка:

    • Спортсменам доступно множество источников белка, у каждого из которых есть свои плюсы и минусы.
    • Источники белка оцениваются на основе содержания аминокислот, особенно концентрации незаменимых аминокислот (EAAs).Другие питательные вещества и химические соединения также влияют на качество белка.
    • Исследования показывают, что содержание лейцина и скорость пищеварения важны для спортивных результатов, роста мышц и восстановления.
    • Белковые смеси, по-видимому, обеспечивают комбинацию полезных питательных веществ, включая лейцин, EAA, биоактивные пептиды и антиоксиданты. Необходимы дальнейшие исследования, чтобы определить идеальный состав для максимальной стимуляции MPS в покое и после тренировки.

    Слово от Verywell

    Правильный источник белка важен для наращивания мышечной массы и сжигания жира.Похоже, что не все белки одинаковы, и для обеспечения качества и эффективности рекомендуется уделять больше внимания профилю незаменимых аминокислот (EAA). Аминокислоты с разветвленной цепью (BCAA), особенно высокая концентрация лейцина в нашем источнике белка, как показано, в первую очередь ответственны за рост, силу и восстановление мышц. Хорошая новость заключается в том, что существует множество вариантов источников белка для ведения активного или соревновательного образа жизни.

    аминокислот для здоровья животных

    Незаменимые аминокислоты: это аминокислоты, которые могут синтезироваться в организме животного, обычно из других аминокислот или других соединений.К ним относятся аланин, аспарагиновая кислота, цистеин, цистин, глутаминовая кислота, глицин, гидроксипролин, пролин, серин и тирозин.

    Хотя «заменимые» аминокислоты могут синтезироваться организмом животного и не нуждаются в добавлении в рацион, они по-прежнему играют важную роль в организме. Термин «несущественные» не имеет отношения к их биологическому значению. Исторически они считались несущественными с точки зрения питания, но недавние научные исследования доказали, что эта точка зрения ложна.Несмотря на свое название, заменимые аминокислоты важны для производства белков, которые способствуют метаболизму и пищеварению, регулируют экспрессию генов, сигнальные клетки, вызывают антиоксидантные реакции, регулируют фертильность, поддерживают нейротрансмиссию и обеспечивают иммунные ответы.

    Независимо от того, считается ли аминокислота незаменимой или несущественной, животным необходимо достаточное количество всех аминокислот для удовлетворения своих метаболических потребностей, независимо от того, нужно ли им производить молоко, наращивать мышцы и ткани или воспроизводить потомство.В зависимости от того, что нужно каждому животному, оно может производить разные белки в разных количествах, что может потребовать разного количества конкретных аминокислот. Таким образом, потребность животного в потреблении аминокислот может меняться в зависимости от его стадии жизни. Например, беременная корова имеет другие потребности в аминокислотах по сравнению с дойной коровой, потому что количество белка, которое им требуется, немного отличается.

    Потенциал животного в производстве белка ограничен количеством аминокислот в его организме.Поскольку для определенных белков требуются определенные аминокислоты, если организм не может синтезировать достаточное количество одной аминокислоты или она не поступает с пищей в достаточном количестве, он не сможет производить определенные типы белков, необходимых для определенных процессов. Самая короткая аминокислота называется «первой ограничивающей» аминокислотой в рационе. Потребность в определенных аминокислотах будет варьироваться в зависимости от вида, пола, диеты и стадии жизни животного. Например, лизин и метионин являются типичными первыми ограничивающими аминокислотами у дойных коров.

    Идентификация этой первой ограничивающей аминокислоты чрезвычайно важна для производственных целей, поскольку животные не могут достичь производственных уровней синтеза белка без достаточных количеств первой ограничивающей аминокислоты; Независимо от того, сколько лизина вы кормите молочной коровой, если метионин является первой лимитирующей аминокислотой, животное может не синтезировать достаточно белков для производства желаемого количества молока. По этой причине обеспечение достаточного количества всех незаменимых аминокислот в рационах производственных животных имеет первостепенное значение.

    Проблемы, связанные с недостатком аминокислот в рационах сельскохозяйственных животных

    Если животное не получает в рационе достаточного количества определенных незаменимых аминокислот, оно не может производить достаточно белков для поддержания определенных метаболических функций. С производственной точки зрения отсутствие достаточного количества аминокислот в рационе животного приведет к снижению общей производительности, что может значительно снизить прибыльность. Вот лишь несколько проблем, связанных с недостаточным снабжением сельскохозяйственных животных аминокислотами:

    1.Изменения в системе впуска

    Одним из первых и наиболее важных признаков дисбаланса аминокислот в корме стада является снижение потребления корма. Хотя большинство животных сначала будут есть больше пищи, чтобы попытаться восполнить дефицит, через несколько дней животные значительно уменьшат потребление пищи. Это снижение потребления происходит потому, что дисбаланс аминокислот в пище приводит к снижению чувства голода у многих видов. Это может способствовать дальнейшему дефициту питательных веществ и, как следствие, к снижению работоспособности и проблемам со здоровьем.

    2. Малая масса тела

    Как у молодых, так и у взрослых животных дефицит аминокислот способствует низкой массе тела и общему снижению мышечного развития. Для молодых животных это может иметь долгосрочные последствия, в том числе снижение скорости роста, увеличение времени для достижения зрелости и уменьшение размера в период созревания. Этот малый вес тела не может быть исправлен с помощью принудительного кормления 3 . Исследования показали, что даже когда животные вынуждены потреблять достаточное количество калорий, если в рационе отсутствуют аминокислоты, животное все равно будет испытывать морфологические проблемы и часто будет продолжать терять вес.

    Гормон роста человека - Протеопедия, жизнь в 3D

    Функция

    Гормон роста человека (hGH) играет жизненно важную роль в росте и развитии. Он естественным образом вырабатывается соматотропными клетками передней доли гипофиза. Гормон вырабатывается как белок-предшественник из 217 аминокислот. 26 N-концевых аминокислот соответствуют сигнальному пептиду, который необходим для секреции гормона. Этот сигнальный пептид расщепляется в процессе секреции с образованием зрелой формы hGH из 191 аминокислоты.

    Зрелый чГР путешествует по кровотоку и взаимодействует со специфическим рецептором чГР на поверхности различных клеток, включая мышцы, кости и хрящи. Связывание hGH с его рецептором вызывает димеризацию и передачу сигнала, что в конечном итоге стимулирует деление клеток. Гормон роста также косвенно влияет на рост, стимулируя печень производить дополнительные факторы роста, такие как инсулиноподобный фактор роста-1. Синтетические версии hGH, полученные с помощью технологии рекомбинантной ДНК, используются для лечения нарушений роста, связанных с дефицитом hGH.Рецептор пролактина (PRLR) также может связываться с гормоном роста и активироваться им.

    Расположение в кузове

    чГР вырабатывается передней долей гипофиза и циркулирует по всему телу. Находясь в кровотоке, чГР взаимодействует с множеством клеток, включая мышечные и костные клетки. В конечном итоге он достигает и стимулирует рост всех основных органов (особенно печени, где он стимулирует выработку факторов роста), за исключением мозга.

    Сигнальный пептид гормона роста

    Гормон роста человека существует в двух формах: пре-GH и зрелый GH.Предварительный белок содержит сигнальный пептид длиной 26 остатков, расположенный на N-конце белка, который отщепляется для образования зрелого белка.

    Сигнальный пептид действует как якорь, удерживая пре-белок связанным с мембраной эндоплазматического ретикулума (ER). Следуя надлежащей передаче сигналов, ER мембраносвязанная сигнальная I пептидаза расщепляет препротеин длиной 217 аминокислот между остатками 26 и 27, что приводит к образованию зрелого секреторного GH длиной 191 остаток (Chawla 1983; Tuteja 2005) [1] .Теперь активный белок высвобождается из мембраны в просвет ER и выводится из клетки.

    Было показано, что мутации остатков в сигнальном пептиде влияют на секрецию GH из клетки. В частности, вариант Lys16Pro связан со сниженными уровнями GH из-за подавленной секреции, что приводит к дефициту гормона роста изолированного типа 1B (IGHD1B) (Millar D.S. 2003) [2] .

    Изоформы

    Было идентифицировано четыре варианта естественного сплайсинга или изоформы гормона роста человека.Различные изоформы образуются, когда сплайсинг пяти экзонов происходит в различных положениях. Обратите внимание, что во всех четырех изоформах первые 26 аминокислот на N-конце присутствуют только в форме предшественника и не являются частью активного гормона. Изоформа 1 является наиболее часто встречающимся вариантом и считается канонической последовательностью, что означает, что она служит ссылкой на другие изоформы с точки зрения расположения признаков. Одно из ключевых отличий других изоформ заключается в том, что, поскольку в них отсутствуют определенные участки аминокислот, то единичные точечные мутации, которые естественным образом возникают в этих областях, не влияют на функцию или активность белков изоформ.Например, существует несколько точечных мутаций, которые происходят в диапазоне аминокислот с 58 по 72, что приводит к снижению способности активировать путь JAK / STAT (Millar et al., 2003). Этот участок отсутствует в изоформе 2, и поэтому этот вариант белка не подвержен таким изменениям. Точно так же существуют одноточечные мутации в диапазоне аминокислот с 111 по 148 и с 117 по 162, которые приводят к снижению секреции (Millar et al., 2003), снижению способности активировать путь JAK / STAT (Millar et al., 2003) и потеря активности (Takahashi et al., 1997) [3] . Следовательно, поскольку в изоформах 2 и 3 отсутствуют эти области, они не подвержены этим различным воздействиям на активность.

    Изоформа 1 (191 аминокислота; MW = 24 847 кДа)

    MATGSRTSLL LAFGLLCLPW LQEGSAFPTI PLSRLFDNAM LRAHRLHQLA FDTYQEFEEAYIPKEQKYSF LQNPQTSLCF SESIPTPSNR EETQQKSNLE LLRISLLLIQ SWLEPVQFLR SVFANSLVYG ASDSNVYDLL KDLEEGIQTL MGRLEDGSPR TGQIFKQTYS KFDTNSHNDDALLKNYGLLY CFRKDMDKVE TFLRIVQCRS VEGSCGF

    Изоформа 2 (176 аминокислот; MW = 22 992 кДа; недостающие аминокислоты 58-72)

    MATGSRTSLL LAFGLLCLPW LQEGSAFPTI PLSRLFDNAM LRAHRLHQLA FDTYQEFNPQTSLCFSESIP TPSNREETQQ KSNLELLRIS LLLIQSWLEP VQFLRSVFAN SLVYGASDSNVYDLLKDLEE GIQTLMGRLE DGSPRTGQIF KQTYSKFDTN SHNDDALLKN YGLLYCFRKDMDKVETFLRI VQCRSVEGSC GF

    Изоформа 3 (153 аминокислоты; MW = 20561 кДа; отсутствующие аминокислоты 111-148)

    MATGSRTSLL LAFGLLCLPW LQEGSAFPTI PLSRLFDNAM LRAHRLHQLA FDTYQEFEEAYIPKEQKYSF LQNPQTSLCF SESIPTPSNR EETQQKSNLE LLRISLLLIQ TLMGRLEDGSPRTGQIFKQ TLMGRLEDGSPRTGQIFKQQ TLMGRLEDGSPRTGQIFKQ

    Изоформа 4 (145 аминокислот; MW = 19802 кДа; отсутствующие аминокислоты 117-162)

    MATGSRTSLL LAFGLLCLPW LQEGSAFPTI PLSRLFDNAM LRAHRLHQLA FDTYQEFEEAYIPKEQKYSF LQNPQTSLCF SESIPTPSNR EETQQKSNLE LLRISLLLIQ SWLEPVQIFKQNLELLRISLLLIQ SWLEPVQIFKQNETCYSKFDGDVQFKQNTYSKF

    Структура

    Первичная последовательность

    hGH продуцируется внутри клетки как пре-белок, состоящий из 191 полипептидной цепи, связанной с сигнальным пептидом из 26 аминокислот.Этот сигнальный пептид участвует в транслокации мембран и в конечном итоге расщепляется с образованием зрелой формы hGH-1. Сигнальный пептид отщепляется от 191 полипептидной цепи hGH-1 с помощью мембраносвязанной протеазы ER (Chawla, Parks, and Rudman, 1983).

    MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEF

    EAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFR SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSH NDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

    Первичная последовательность предшественника hGH-1

    Вариации первичной последовательности между изоформами:

    hGH-1 (самая распространенная изоформа): имеет первичную аминокислотную последовательность из 191 аминокислоты Изоформа 2: аминокислотные остатки 58-72 hGH-1 исключены Изоформа 3: исключает аминокислотные остатки 111-148 Изоформа 4: исключает аминокислотные остатки 117-162

    Вторичная структура

    hGH представляет собой одноцепочечный пептид, спиральный на 45% с 8 α-спиралями (Chantalat et al., 1995) [4] . Protein Data Bank (PDB) предоставляет предсказанные вторичные структуры различных белков с использованием исследований из статьи и программы алгоритма.

    Третичная структура

    Известная кристаллическая структура hGH показывает, что ядро ​​белка представляет собой пучок из четырех спиралей. Спирали 1 и 4 на концах Nh3 и COOH длиннее спиралей 2 и 3 (Abraham 1992). Короткая петля соединяет спирали 2 и 3, а два длинных перекрестных соединения соединяют спирали 1 и 2 и спирали 3 и 4.Спирали движутся вверх-вверх-вниз-вниз (Abraham, 1992). Это необычно, потому что обычно четыре пучка спиралей имеют ориентацию вверх-вниз-вверх-вниз.

    Еще три спирали гораздо меньшего размера существуют внутри соединительных петель: одна в начале соединения между спиралями 1 и 2, одна в конце соединения между спиралями 1 и 2 и одна в соединении короткой петлей между спиралями 2 и 3. (Авраам 1992).

    Посттрансляционные модификации

    Фосфорилирование
    HGH фосфорилируется по остаткам Ser 132 и 176 (Giorgianni, Beranova-Giorgianni, and Desiderio, 2004) [5] .Другое исследование показало возможное фосфорилирование остатков Tyr 35 и 42. Однако эти фосфорилирования были исследованы только на клетках карциномы с конститутивно активной тирозинкиназой, стимулированной эпидермальным фактором роста (Baldwin et al., 1983) [6] . Общее влияние этих посттрансляционных модификаций на активность hGH еще предстоит определить.

    Сайт связывания рецептора

    Рецептор связывается с остатками Phe54 и Glu74 hGH

    Механизм секрета

    Ранее считалось, что после стимуляции секреции гормона роста секреторные везикулы, связанные с мембраной, содержащие гормон, присоединяются к плазматической мембране клетки.Считалось, что эти везикулы полностью включены в плазматическую мембрану и позже будут извлечены посредством эндоцитоза, что позволит пассивно высвобождать гормон роста внутри везикул. Однако этот механизм не подтверждается экспериментальными данными, такими как появление пустых и частично пустых пузырьков сразу после секреции. Лаборатория Бхану Джены недавно выяснила молекулярный механизм клеточной секреции. Их исследования показывают, что на самом деле существует новая клеточная структура, называемая поросомой, которая участвует в этом механизме.Поросомы представляют собой «корзинообразные» структуры, расположенные на плазматической мембране, которые имеют отверстие диаметром 100–150 нм во внеклеточную среду (рис. 1). Вместо того, чтобы стыковаться непосредственно с плазматической мембраной после стимуляции секреции, связанные с мембраной секреторные везикулы сливаются в основании поросом, которые впоследствии вытесняют везикулярное содержимое (Рис. 2). Во время стимуляции отверстие расширяется примерно на 20-35%, что способствует выведению гормона роста. По завершении процесса поросома возвращается к исходному размеру (Anderson et al., 2004) [7] .

    Существует несколько гипоталамических гормонов, контролирующих высвобождение гормона роста. Самый главный из этих стимулов секреции - фактор высвобождения гормона роста (GHRH). Напротив, известно, что гормон, известный как соматостатин (SRIF), подавляет высвобождение GH соматотропом. Эти два гормона являются наиболее известными, хотя следует отметить, что существует множество других факторов контроля, которые как стимулируют, так и подавляют выброс гормона роста в кровоток (Anderson et al., 2004).

    Механизм действия

    Для облегчения такого поведения гормон соматотропин связывается с двумя рецепторами вне клетки, известными как белки, связывающие гормон роста человека (hGHpb). Как только гормон роста человека связывает оба рецептора (первый, затем второй), он вызывает сдвиг в рецепторном белке, который, в свою очередь, вызывает внутренний сигнальный каскад. Этот каскад показывает, как соматотропин может влиять на рост и функционирование клеток. Кроме того, он может вызывать высвобождение других факторов роста, таких как фактор роста инсулина.

    Ингибиторы

    Соматостатин

    Первичный механизм регуляции гормона роста в организме состоит в высвобождении соматостатина, также известного как гормон, ингибирующий гормон роста (GHIH). Соматостатин вырабатывается в гипоталамусе и выделяется передней долей гипофиза, поджелудочной железой и желудочно-кишечным трактом (Somatostatin, 2011). Этот гормон работает вместе с гормоном высвобождения гормона роста (GHRH), чтобы должным образом регулировать секрецию hGH из гипофиза. На уровень соматостатина напрямую влияет уровень циркулирующего hGH.В частности, уровни соматостатина высоки, когда концентрация hGH высока, и низка, когда hGH низка.

    В организме обнаружены две формы соматостатина. Одна форма, известная как SS-14, состоит из 14 аминокислот и обнаруживается в основном в нервной системе и поджелудочной железе. Другой имеет длину цепи аминокислот 28 и называется SS-28. Эта форма встречается преимущественно в желудочно-кишечном тракте. SS-28 является гораздо более сильным ингибитором hGH, чем SS-14 (Bowen, 2002). Большинство рецепторов организма не различают две формы соматостатина.Все рецепторы являются рецепторами, связанными с G-белком, и ингибируют аденилциклазу, которая, в свою очередь, влияет на ряд гормонов и вторичных мессенджеров (Bowen, 2002).

    Глюкокортикоиды

    Глюкокортикоиды - это тип стероидных гормонов, которые регулируют уровень гормона роста двумя разными способами. Исследования показали, что глюкокортикоиды способны подавлять высвобождение GHRH, а также снижать чувствительность рецептора GHRH (Miller et al., 1997) [8] . Из-за подавления GHRH уровни hGH в организме в конечном итоге снижаются.Есть также данные, позволяющие предположить, что глюкокортикоиды работают с высвобождением соматостатина в гипоталамусе (Lima et al., 1993) [9] .

    Помимо взаимодействия с GHRH и соматостатином, глюкокортикоиды могут влиять на адренергические рецепторы (как альфа-2-адренорецепторы, так и бета-адренорецепторы, которые стимулируются катехоламинами в симпатической нервной системе. Было показано, что при стимуляции альфа-рецепторы стимулируют высвобождение гормона роста), тогда как стимуляция бета-рецепторов может подавлять высвобождение гормона роста (Blackard, 1968).

    Гипергликемия и инсулин

    Высокий уровень сахара в организме обычно сопровождается повышенным уровнем инсулина. Было показано, что в этом состоянии инсулин и родственные гормоны, такие как инсулиноподобный фактор роста (IGF-1), снижают аффинность связывания между hGH и его рецепторами (Shaonin et al., 1997). При более низких уровнях инсулина и IGF-1 секреция и уровни hGH могут быстро и непрерывно повышаться. Хотя инсулин и IGF-1 не действуют напрямую на рецепторы hGH, они могут влиять на сигнальный каскадный путь, который использует hGH (Yakar et al., 2004) [10] . JAK2 является одним из белков, обнаруженных в этом сигнальном пути, и, как известно, на него воздействуют петли обратной связи и регуляции hGH / инсулина (Shaonin et al., 1997).

    Сопутствующие болезни и методы лечения

    Заболевания, связанные с гормоном роста человека, связаны с дефицитом или перепроизводством гормона.

    Дефицит соматостатина может возникнуть в детстве или в зрелом возрасте. Врожденная недостаточность обычно связана с аномалией гипофиза, но также может быть частью более крупного синдрома или состояния1.Приобретенный дефицит может развиваться из нескольких источников, включая инфекцию, опухоли головного мозга, травму, операцию на головном мозге или облучение головы1. Есть случаи, в которых прямую причину установить невозможно. Опухоли гипофиза, подвергшиеся хирургическому или лучевому лечению, обычно являются причиной дефицита гормона роста у взрослых.

    Симптомы дефицита у детей включают низкий рост, медленный рост, позднее начало полового созревания, увеличение жира вокруг талии и задержку развития зубов1. Гипофизарный карликовость может возникнуть в результате невылеченного дефицита у детей.У взрослых симптомы включают низкий уровень энергии, снижение силы и мышечной массы, низкую выносливость, увеличение веса (особенно в области талии), беспокойство, депрессию и тонкую сухую кожу1.

    Дефицит может также вызывать повышение уровня общего холестерина, ЛПНП (липопротеинов низкой плотности), аполипопротеина B и триглицеридов, а также может снижать плотность костной ткани.

    Общее лечение карликовости - инъекции HgH. Чем раньше будет начато это лечение, тем эффективнее оно будет в преодолении пагубных последствий дефицита HgH.Эти инъекции применяются от нескольких раз в неделю до одного раза в день. Дальнейшая помощь людям, страдающим карликовостью с дефицитом HgH, включает психологическую терапию, которая помогает справиться с социальными последствиями такого низкого роста (гормон роста A.D.A.M.).

    Инъекция GH была причастна к развитию болезни Крейтцфельдта-Якоба. Эта ассоциация была обнаружена только в GH, изолированном от трупов. Первоначально выделение белка из трупов было методом разработки заместительной терапии.В настоящее время рекомбинантные методы производства являются основным методом синтеза. По-видимому, нет связи между продуцируемым рекомбинантной ДНК GH и болезнью Крейтцфельдта-Якоба2.

    Болезни также могут быть результатом слишком высокого уровня GH. Эффекты избыточного гормона роста зависят от возраста. Гигантизм - это избыток гормона роста в детстве, а акромегалия - это избыток гормона роста в зрелом возрасте (после прекращения роста костей). Симптомы гигантизма включают задержку полового созревания, двоение в глазах, головную боль, повышенное потоотделение, большие руки и ноги и слабость3.Симптомы акромегалии незначительно различаются и включают запах тела, синдром запястного канала, усталость, слабость, повышенное потоотделение, боль в суставах, большие руки и ноги, апноэ во сне, утолщение кожи, широко расставленные зубы и непреднамеренную потерю веса4.

    Избыточное высвобождение гормона роста чаще всего происходит из-за опухоли гипофиза3. Это также может быть связано с комплексом Карни, синдромом МакКьюна-Олбрайта, множественной эндокринной неоплазией 1 типа и нейрофиброматозом3. Лечение включает в себя лекарства для уменьшения выработки гормонов и, в тяжелых случаях, удаление гипофиза.

    Акромегалия, или гигантизм, чаще всего лечится хирургическим путем. Удаление опухоли в гипофизе может остановить избыточный выброс гормона роста. Это полностью удается примерно в 60 процентах случаев. Неполный успех часто объясняется размером опухоли; большие опухоли не всегда могут быть полностью удалены, что приводит к продолжающемуся высокому уровню высвобождения гормонов (Freda, 2002) [11] .

    Хирургия часто дополняется, а в некоторых случаях заменяется лучевой терапией.Облучение гипофиза может помочь снизить уровень высвобождения гормонов, убивая опухолевые клетки, но уменьшение высвобождения в результате облучения - медленный процесс и не такой успешный, как хирургическое вмешательство. По этой причине его чаще используют вместе с хирургией, а не отдельно (Freda, 2002; A.D.A.M. Acromegaly).

    Некоторые лекарства также можно использовать в комбинации с хирургическим вмешательством и лучевой терапией. Существует две классификации лекарств от акромегалии. Первый снижает выброс HgH из гипофиза.Агонисты соматостатина снижают высвобождение HgH примерно у 50 процентов пациентов. Они действуют путем связывания с рецепторами соматостатина, которые регулируют гормональный контроль. На первый взгляд низкий уровень успеха объясняется устойчивостью некоторых опухолей к агонистам соматостатина. В настоящее время на рынке представлены два агониста соматостатина. Октреотид - это лекарство длительного действия, которое необходимо вводить примерно раз в месяц.


    Добавить комментарий

    Ваш адрес email не будет опубликован. Обязательные поля помечены *

    *
    *