Вход в личный кабинет | Регистрация
Избранное (0) Список сравнения (0)
Ваши покупки:
0 товаров на 0 Р
Итого: 0 Р Купить

Matrix протеин: Matrix 5.0 от Syntrax — цена: от 1 692 руб. — купить протеин недорого в Москве

Содержание

Syn Matrix 5.0 (2270 гр.)

Matrix от Syntrax

Протеин, имеющий лучший вкус - гарантированно!

Проблема

Ничем не примечательный протеин, который может "похвастаться" невысоким качеством, мальтодекстрином в своем составе, который ведет к накоплению жира, вкус протеина ужасен, каждый раз вам нужен блендер для размешивания протеина, и, более того, в составе присутствует всего один "быстрый" протеин. Наверняка за каждую из упаковок такого протеина просят небольшие деньги, но кто захочет связать свою ежедневную жизнь с протеином, который и неудобен, и неэффективен?

Решение

Syntrax Matrix 5.0, являясь результатом продолжительных исследований, не имеет ни одного из перечисленных выше недостатков. В составе вы не увидите дешевого, низкопробного протеинового сырья, такого как денатурированный казеинат натрия и кальция. Для достижения наилучших результатов в Syntrax Matrix используется исключительно неденатурированный протеин высочайшего качества, такой как ультрафильтрованный сывороточный протеин, ультрафильтрованный молочный протеин, неденатурированный яичный белок, а также глютаминовые пептиды.

Цена выше, но качество и результат заметны моментально. Syntrax Matrix обладает отличным вкусом, улучшает здоровье организма в целом, положительно влияет на рост тканей и восстановительные процессы.

Лучшая протеиновая смесь

  • Неденатурированный сывороточный протеин
  • Мицеллярный казеин и яичный белок
  • Анаболические и антикатаболичские протеин
  • Глютаминовые пептиды
  • Легко смешивается

В качестве вкусовых араматов выбраны бесспорные лидеры: Simply Vanilla и Perfect Chocolate. Syntrax Matrix 2.0 растворяется без каких-либо усилий даже обычной ложкой, а вы получаете превосходный протеиновый коктейль. Больше никаких комочков, никаких блендеров - для Matrix 2.0 Вам может потребоваться только ложка!

Рекомендации по применению

Растворите одну- две мерные ложки Matrix 2.0 в 250-300 мл воды, нежирного молока. Принимайте Matrix 2.0 два -три раза в день, чтобы восполнить запасы протеина. Помните,что наилучшее время приема- это с утра после пробуждения, после интенсивных тренировок и перед сном.

Ингредиенты

Порция - 30 г (отличаются по вкусам)
Количество порций - 76 (отличаются по вкусам)
Состав в одной порции
Энергетическая ценность 120 ккал
в т. ч. калории от жиров 15 ккал
Питательная ценность:
Белок 23 г
Всего жиров 2 г
в т. ч. насыщенные жиры 1 г
Холестерин 30 мг
Всего углеводов 3 г
Кальций 160 мг
Фосфор 140 мг
Магний 20 мг
Натрий 105 мг
Калий 200 мг
Аминокислотный состав на 100 г протеина:
Аргинин 2,5 г
Глютамин 8,4 г
Гистидин 2,1 г
Изолейцин 5,8 г
Лейцин 10,3 г
Лизин 8,7 г
Метионин 2,2 г
Фенилаланин 3,6 г
Треонин 6,4 г
Триптофан 1,9 г
Валин 6,0 г
Ингредиенты: Ультрафильтрованный и неденатурированный концентрат сывороточного протеина, ультрафильтрованный и неденатурированный концентрат молочного протеина (включая мицеллярный казеин), неденатурированный яичный белок, гидролизованная пшеничная клейковина. Продукт не является лекарственным средством.
Не рекомендуем использовать продукцию лицам, не достигшим 18 лет.
Перед началом приема любого продукта обязательно проконсультируйтесь у специалиста!
  • Леонид 3 апреля 2021 12:14

    2290 г

    Это правда, что самый вкусный протеин на рынке. Сегодня возьму третий раз уже. Размешивается ооочень легко, 3-4 раза тряснуть шейкер и размешалось. размешиваю только водой, с молоком приторно. протеин рабочий, к нему есть доверие. Советую

  • Михаил 30 января 2019 12:52

    2290 г

    Плюсы: Хороший универсальный продукт для тех, кто хочет начать употреблять, но не знает как и не осознает зачем.

    Классический многостаночник с двумя нужными функциями: 1. Полезный перекус, перебивающий чувство голода на 2-3 часа (субъективные ощущения+состав). 2. Отличный посттренировочный восстановительный коктейль особенно если тренировка вечером (анализ состава+отзывы интернетов, ютубов+ собственные ощущения). Вкус, даже на воде очень приличный, ложкой мешается плохо, особенно если разводить сильно горячей водой:)) В составе есть БЦА и витаминки. Минусы: В основном вытекают из универсальности. То есть для конкретных целей его эффективность наверняка будет ниже монопрофильных продуктов. Для вкачать мяса по-бодрому, пожалуй тоже не подойдет, по отзывам судя больше 2-х раз в день и дольше месяца подряд употреблять чревато проблемами с ЖКТ.

  • Алексей 2 января 2019 11:22

    2290 г

    На счет растворимости я бы поспорил что он растворяется без ложки.

    Комочки все же есть и перемешивать приходится достаточно интенсивно

Показать еще отзывы Для данного товара видео отсутствует

Протеин Syntrax Matrix 2.

0 (0.9кг)

Matrix 2.0 представляет собой смесь трех протеинов высочайшего качества: ультрафильтрованного сывороточного протеина, ультрафильтрованного молочного протеина, включающего мицеллярный казеин, яичного альбумина с добавлением глютаминовых пептидов.

Это продукт с великолепным вкусом и способностью не только улучшить здоровье и общее самочувствие, но и существенно увеличить мышечную массу.

Яичный альбумин - белок с идеальным аминокислотным профилем, способствует набору сухой мышечной массы, содержит ценные микронутриенты и факторы роста.

Сывороточный протеин имеет наибольшую скорость усвоения, мгновенно насыщает кровь незаменимыми аминокислотами и запускает процесс анаболизма, к тому же у него ярко выражены иммуно-стимулирующие свойства.

Казеин, напротив, признан наиболее медленно усваивающимся белком, однако это свойство позволяет поддерживать постепенное регулярное поступление аминокислот в кровь в течение длительного времени, что препятствует разрушению приобретенных мышц.

Таким образом, выбранные производителем три вида протеина идеально дополняют друг друга.

Matrix содержит белки с быстрой, средней, и медленной скоростью усвоения, поэтому он подходит для употребления в любое время дня, надежно обеспечивая Ваши мышцы протеином.

СОСТАВ:

Протеиновая смесь (ультрафильтрованный неденатурированный концентрат сывороточного протеина, ультрафильтрованный неденатурированный концентрат молочного протеина, включая мицеллярный казеин, неденатурированный яичный альбумин, гидролизованный пшеничный глютен, как источник глютаминовых пептидов), натуральные и искусственные ароматизаторы, соевый лецитин, хлорид натрия, ацесульфам-К, сукралоза.

РЕКОМЕНДАЦИИ ПО ПРИМЕНЕНИЮ:

Смешайте одну мерную ложку продукта с 240 мл воды или молока. (Если потребность в протеине не очень велика - можно принимать половину порции.) Принимайте 2–3 раза в день в зависимости от своих потребностей в качественном протеине. Помните, что лучше всего принимать протеин утром, сразу после пробуждения, после интенсивных физических упражнений и непосредственно перед сном. Matrix 2.0 легко смешивается при помощи обыкновенной ложки и имеет превосходный вкус!

Matrix 5.0 2,27 кг от Syntrax

Отличительные особенности Syntrax Matrix
Технологи компании Syntrax при создании протеинового комплекса Matrix® полностью отказались от таких дешевых источников белка как денатурированные казеинаты кальция и натрия.
В состав Matrix® входят только протеины высочайшего качества: ультрафильтрованный сывороточный протеин, ультрафильтрованный молочный протеин, натуральный яичный альбумин и пептиды глютамина. Они стоят намного дороже, но качество является залогом эффективности данного продукта.
Matrix® не только обладает превосходным вкусом, но и положительно влияет на состояние здоровья.
Все источники белка имеют по отдельности свои сильные и слабые стороны. Например, яичный протеин идеально усваивается и содержит большое количество факторов роста, но при этом очень недешев.  Сывороточный протеин быстрее всего усваивается и улучшает иммунитет. Казеин долго усваивается и поэтому способен подпитывать мышцы аминокислотами длительный промежуток времени.

Соответственно, хотя каждый из источников белка имеет много преимуществ, но их комплекс будет работать лучше, сочетая в себе все их плюсы и минимизируя недостатки.
Благодаря сочетанию высококачественных источников белка Matrix® обладает одним из лучших аминокислотных профилей на рынке спортивного питания. Он способствует увеличению мышечной массы и уменьшению жировой, обладает антиоксидантным действием, улучшает состояние иммунной системы, не оказывает негативного воздействия на почки и многое др.
Так как в  состав Matrix® входят протеины с различной скоростью усвоения, его можно принимать в любое время: как после тренировки, так и перед сном.
Несмотря на высочайшее качество стоимость Matrix® 5.0 относительно невелика, благодаря использованию экономичной ламинированной упаковки, которая позволяет сохранить все качества продукта, не увеличивая его цену.

Применение Matrix® 5.0:
Разведите 1 мерную ложку продукта (32 грамма) в 200-300 мл воды, обезжиренного молока или сока по вашему вкусу. Принимайте в течение дня между приемами пищи. Общее количество порций  зависит от массы тела, интенсивности  тренировок, общего потребления белковой пищи и калорийности рациона. Общее дневное потребление белка для ведущих активный образ жизни людей,  рекомендуется от 1,5-2 грамм на 1 кг массы тела.

Протеин Syntrax Matrix 5.0 - калорийность, полезные свойства, польза и вред, описание

Калории, ккал: 

393

Углеводы, г: 

9.5

Matrix 5.0 – популярная многосоставная протеиновая смесь от американской компании Syntrax. Упаковка продукта представляет собой ламинированный пакет на многоразовой гибкой молнии-застежке, позволяющей сохранить полезность смеси в течение всего периода употребления. В продаже доступен протеин со вкусом шоколада, ванили, а также мятного пряника, клубники и печенья «Арахисовое масло».

Калорийность протеина Syntrax Matrix 5.0

Калорийность протеина Syntrax Matrix 5.0 составляет 393 ккал на 100 грамм сухого продукта.

Состав протеина Syntrax Matrix 5.0

Для изготовления используются: ультрафильтрованный и неденатурированный концентрат сывороточного протеина, ультрафильтрованный и неденатурированный концентрат молочного протеина, включая мицеллярный казеин, неденатурированный яичный белок, гидролизованная пшеничная клейковина, натуральные и искусственные ароматизаторы, соевый лецитин, натрия хлорид, ацесульфам-К, сукралоза.

Продукт имеет насыщенный аминокислотный состав. Питательность одной порции (мерная ложка – около 30-32 грамм): калории – 120, белков – 23 г, жиров – 2 г, углеводов – 3 г, а также натрия – 150 мг и калия – 270 мг.

Упаковка содержит около 76 порций. Продукт не является лекарством.

Протеин Syntrax Matrix 5.

0 в спорте

Поскольку продукт содержит три вида разных изолятов, он идеален для строительства сухой мышечной массы, уменьшения жировых отложений, обладает антиоксидантными свойствами и повышает иммунитет спортсмена (calorizator). Благодаря употреблению данного продукта обеспечивается положительный азотистый баланс и стабильный уровень инсулина в крови, что очень важно для процессов восстановления и роста мышц организма.

Способ приготовления протеина Syntrax Matrix 5.0

Для удобства измерений порций в упаковке имеется специальная мерная ложка (около 30-32 грамм смеси). На приготовление одного коктейля необходимо размешать в стакане воды или молока низкой жирности мерную ложку смеси. Важно понимать, что чем выше жирность молока, тем более калорийным получится коктейль (калоризатор). Принимать протеин можно до 2-3 раз в день: сразу после пробуждения, по окончании интенсивных тренировок и непосредственно перед сном, не забывая «вписывать» приём коктейля в свою суточную калорийность.

Противопоказания к применению протеина Syntrax Matrix 5.0

Индивидуальная непереносимость компонентов продукта, беременность и кормление грудью, лица младше 18 лет. Перед применением проконсультироваться с врачом.

Syntrax Matrix 5.0 банан по низким ценам в городе Курган

Протеин, имеющий лучший вкус - гарантированно!

Проблема

Ничем не примечательный протеин, который может "похвастаться" невысоким качеством, мальтодекстрином в своем составе, который ведет к накоплению жира, вкус протеина ужасен, каждый раз вам нужен блендер для размешивания протеина, и, более того, в составе присутствует всего один "быстрый" протеин. Наверняка за каждую из упаковок такого протеина просят небольшие деньги, но кто захочет связать свою ежедневную жизнь с протеином, который и неудобен, и неэффективен?

Решение

Syntrax Matrix 5.0, являясь результатом продолжительных исследований, не имеет ни одного из перечисленных выше недостатков. В составе вы не увидите дешевого, низкопробного протеинового сырья, такого как денатурированный казеинат натрия и кальция. Для достижения наилучших результатов в Syntrax Matrix используется исключительно неденатурированный протеин высочайшего качества, такой как ультрафильтрованный сывороточный протеин, ультрафильтрованный молочный протеин, неденатурированный яичный белок, а также глютаминовые пептиды. Цена выше, но качество и результат заметны моментально. Syntrax Matrix обладает отличным вкусом, улучшает здоровье организма в целом, положительно влияет на рост тканей и восстановительные процессы.

Лучшая протеиновая смесь
  • Неденатурированный сывороточный протеин
  • Мицеллярный казеин и яичный белок
  • Анаболические и антикатаболичские протеин
  • Глютаминовые пептиды
  • Легко смешивается

В качестве вкусовых араматов выбраны бесспорные лидеры: Simply Vanilla и Perfect Chocolate. Syntrax Matrix 5.0 растворяется без каких-либо усилий даже обычной ложкой, а вы получаете превосходный протеиновый коктейль. Больше никаких комочков, никаких блендеров - для Matrix 5.0 Вам может потребоваться только ложка!

Рекомендации по применению

Растворите одну- две мерные ложки Matrix 2.0 в 250-300 мл воды, нежирного молока. Принимайте Matrix 2.0 два -три раза в день, чтобы восполнить запасы протеина. Помните,что наилучшее время приема- это с утра после пробуждения, после интенсивных тренировок и перед сном.

Продукт не является лекарственным средством.
Не рекомендуем использовать продукцию лицам, не достигшим 18 лет.
Перед началом приема любого продукта обязательно проконсультируйтесь у специалиста!

Matrix 5.0 (Matrix) 2290 g

Высококачественный многокомпонентный протеин!

Syntrax Matrix 5.0

Набор мышечной массы!

В составе вы не увидите дешевого, низкопробного протеинового сырья, такого как денатурированный казеинат натрия и кальция!

 

Для достижения наилучших результатов в Syntrax Matrix используется исключительно неденатурированный протеин высочайшего качества, такой как ультрафильтрованный сывороточный протеин, ультрафильтрованный молочный протеин, неденатурированный яичный белок, а также глютаминовые пептиды.

Качество и результат заметны моментально!

Syntrax Matrix обладает отличным вкусом, улучшает здоровье организма в целом, положительно влияет на рост тканей и восстановительные процессы.

 

Содержание питательных веществ в одной порции (1 ложка ≈ 32 г) продукта:
Калории – 120, в т. ч. Калории от жиров – 15
Всего жиров – 2 г, в т. ч. Насыщенные жиры – 1 г
Холестерин – 40 мг
Натрий – 150 мг
Калий – 270 мг
Всего углеводов – 3 г
Протеин – 23 г

Аминокислотный состав на 100 г протеина:
Аргинин – 2,5 г 
Глютамин – 8,4 г 
Гистидин – 2,1 г 
Изолейцин – 5,8 г 
Лейцин – 10,3 г 
Лизин – 8,7 г 
Метионин – 2,2 г 
Фенилаланин – 3,6 г 
Треонин – 6,4 г 
Триптофан – 1,9 г 
Валин – 6,0 г

Ингредиенты: протеиновая смесь Matrix (ультрафильтрованный и неденатурированный концентрат сывороточного протеина, ультрафильтрованный и неденатурированный концентрат молочного протеина (включает в себя казеин), неденатурированный яичный белок, гидролизованная пшеничная клейковина (источник глютаминовых пептидов)), натуральные и искусственные ароматизаторы, лецитин, хлорид натрия, аспартам, ацесульфам калия.

Лучшая протеиновая смесь:

  • Неденатурированный сывороточный протеин
  • Мицеллярный казеин и яичный белок
  • Анаболические и антикатаболичские протеин
  • Глютаминовые пептиды
  • Легко смешивается

В качестве вкусовых араматов выбраны бесспорные лидеры: Simply Vanilla и Perfect Chocolate. Syntrax Matrix растворяется без каких либо усилий даже обычной ложкой, а вы получаете превосходный протеиновый коктейль. Больше никаких комочков, никаких блендеров - для Matrix Вам может потребоваться только ложка!

Рекомендации по применению:

Растворите одну или две мерные ложки Matrix  в 250-300 мл воды, нежирного молока. Принимайте Matrix два - три раза в день, чтобы восполнить запасы протеина. Помните,что наилучшее время приема - это с утра после пробуждения, после интенсивных тренировок и перед сном или между основными приемами пищи.

Порций в упаковке: 71

Syntrax Matrix 5.0 — Бутик Спортивного Питания

Описание

Протеин, имеющий лучший вкус — гарантированно!

Проблема:

Ничем не примечательный протеин, который может «похвастаться» невысоким качеством, мальтодекстрином в своем составе, который ведет к накоплению жира, вкус протеина ужасен, каждый раз вам нужен блендер для размешивания протеина, и, более того, в составе присутствует всего один «быстрый» протеин. Наверняка за каждую из упаковок такого протеина просят небольшие деньги, но кто захочет связать свою ежедневную жизнь с протеином, который и неудобен, и неэффективен?

Решение:

Syntrax Matrix 5.0, являясь результатом продолжительных исследований, не имеет ни одного из перечисленных выше недостатков. В составе вы не увидите дешевого, низкопробного протеинового сырья, такого как денатурированный казеинат натрия и кальция. Для достижения наилучших результатов в Syntrax Matrix используется исключительно неденатурированный протеин высочайшего качества, такой как ультрафильтрованный сывороточный протеин, ультрафильтрованный молочный протеин, неденатурированный яичный белок, а также глютаминовые пептиды. Цена выше, но качество и результат заметны моментально. Syntrax Matrix обладает отличным вкусом, улучшает здоровье организма в целом, положительно влияет на рост тканей и восстановительные процессы.

Лучшая протеиновая смесь:

  • Неденатурированный сывороточный протеин
  • Мицеллярный казеин и яичный белок
  • Анаболические и антикатаболичские протеин
  • Глютаминовые пептиды
  • Легко смешивается

В качестве вкусовых араматов выбраны бесспорные лидеры: Simply Vanilla и Perfect Chocolate. Syntrax Matrix 2.0 растворяется без каких либо усилий даже обычной ложкой, а вы получаете превосходный протеиновый коктейль. Больше никаких комочков, никаких блендеров — для Matrix 2. 0 Вам может потребоваться только ложка!

Рекомендации по применению:

Растворите одну- две мерные ложки Matrix 2.0 в 250-300 мл воды, нежирного молока. Принимайте Matrix 2.0 два -три раза в день, чтобы восполнить запасы протеина. Помните,что наилучшее время приема- это с утра после пробуждения, после интенсивных тренировок и перед сном.

2290 г апельсин
Порция — 30 г
Количество порций — 76
 
Состав в одной порции
Энергетическая ценность 120 ккал
в т. ч. калории от жиров 15 ккал
Питательная ценность:
Белок 23 г
Всего жиров 2 г
в т. ч. насыщенные жиры 1 г
Холестерин 30 мг
Всего углеводов 3 г
Кальций 160 мг
Фосфор 140 мг
Магний 20 мг
Натрий 105 мг
Калий 200 мг
 
Аминокислотный состав на 100 г протеина:
Аргинин 2,5 г
Глютамин 8,4 г
Гистидин 2,1 г
Изолейцин 5,8 г
Лейцин 10,3 г
Лизин 8,7 г
Метионин 2,2 г
Фенилаланин 3,6 г
Треонин 6,4 г
Триптофан 1,9 г
Валин 6,0 г

Ингредиенты: Ультрафильтрованный и неденатурированный концентрат сывороточного протеина, ультрафильтрованный и неденатурированный концентрат молочного протеина (включая мицеллярный казеин), неденатурированный яичный белок, гидролизованная пшеничная клейковина.

Viral Matrix Protein - обзор

5 Сборка вирусных матричных белков

Матричные белки вирусов РНК с отрицательной цепью первоначально синтезируются как растворимые белки в цитоплазме, которые затем разделяются на мембраны в различной степени в зависимости от типа вирус и экспериментальные условия. Для большинства вирусов ассоциация с мембранами происходит независимо от других вирусных компонентов и, вероятно, включает взаимодействие с липидами мембран. Для некоторых вирусов, таких как VSV, вирус Эбола и вирус гриппа, было показано, что отрицательно заряженные фосфолипиды способствуют взаимодействию вирусного матричного белка с мембранами (Ruigrok, Barge, et al., 2000; Ruigrok, Schoehn и др., 2000; Заковски, Петри и Вагнер, 1981). Поскольку эти липиды обогащены на цитоплазматической поверхности плазматических мембран хозяина, это приводит к преимущественной локализации этих матричных белков на плазматической мембране.

Подобно вирусным белкам оболочки, вирусные матричные белки, вероятно, не распределены случайным образом в плазматической мембране хозяина, а вместо этого организованы в микродомены мембраны. В случае VSV и вируса гриппа микродомены, содержащие матриксный белок, в плазматических мембранах хозяина были продемонстрированы путем анализа кластеризации частиц иммунного золота на электронных микрофотографиях (Chen, Leser, Jackson, & Lamb, 2008; Swinteck & Lyles, 2008).В некоторых случаях, таких как вирус кори (Pohl, Duprex, Krohne, Rima, & Schneider-Schaulies, 2007) и вирус Эбола (Bavari et al., 2002; Panchal et al., 2003), белки вирусного матрикса присутствуют в моющем средстве. -резистентные липидные рафты при экспрессии в отсутствие других вирусных белков. Однако в других случаях, таких как вирус гриппа (Ali, Avalos, Ponimaskin, & Nayak, 2000), вирус Сендай (Ali & Nayak, 2000) и респираторно-синцитиальный вирус (Henderson, Murray, & Yeo, 2002), коэкспрессия Гликопротеины вирусной оболочки необходимы для того, чтобы белки вирусного матрикса присутствовали во фракциях мембран, устойчивых к детергентам, предположительно в тех же микродоменах, которые содержат гликопротеины оболочки.В самом деле, совместная локализация белка M1 вируса гриппа в микродоменах плазматической мембраны хозяина, содержащих HA, была продемонстрирована анализом иммуноэлектронных микрофотографий (Chen et al., 2008). Однако аналогичный анализ VSV-инфицированных клеток показал, что M-белок и G-белок находятся в отдельных мембранных микродоменах, и единственное место, где они колокализовались, было на сайтах почкования вируса (Swinteck & Lyles, 2008). Точно так же матричный (Z) белок аренавируса Junin не колокализуется с GPC-содержащими микродоменами (Agnihothram et al., 2009). Как и в случае образования вирусного псевдотипа, присутствие вирусных белков в отдельных мембранных микродоменах, которые собираются вместе в сайтах почкования вируса, подразумевает своего рода движущую силу для кластеризации или слияния этих мембранных микродоменов.

Большинство учебных моделей сборки вирусов постулируют прямое взаимодействие между вирусными матриксными белками и цитоплазматическими доменами гликопротеинов вирусной оболочки как движущую силу сборки вируса. Однако биохимически продемонстрировать такое прямое взаимодействие было очень сложно.Например, большинство гликопротеинов оболочки легко солюбилизируются из вирионов, свободных от матричных белков, даже с помощью самых мягких моющих средств, что исключает использование типичных подходов иммунопреципитации или аффинного осаждения («выпадающего»). Таким образом, если такое взаимодействие существует, вероятно, оно будет иметь низкое сродство. В экспериментах в нашей лаборатории (Lyles, McKenzie, & Parce, 1992) было показано, что M-белок и G-белок, очищенные от VSV в присутствии детергента, взаимодействуют друг с другом с умеренным сродством ( K d ∼ 20 нМ ) и относительно быстрая скорость уравновешивания ( т 1/2 ∼ 5–10 мин).Это взаимодействие проявлялось в стабилизации тримеров G-белка в присутствии M-белка, что было проанализировано с помощью флуоресцентной спектроскопии. Однако нельзя было окончательно продемонстрировать, что стабилизация тримеров G-белка происходила из-за взаимодействия M-белка с цитоплазматическим доменом G-белка или, альтернативно, с мицеллами детергента, связанными с трансмембранным доменом. Были сообщения о взаимодействии белков вирусного матрикса с гликопротеинами оболочки в клеточных лизатах с использованием коиммунопреципитации или аналогичных подходов (например,г., Capul, de la Torre, & Buchmeier, 2011; Капул и др., 2007; Пантуа, МакГиннес, Пиплз и Моррисон, 2006 г.). Однако эти результаты могут быть связаны с большими поливалентными комплексами, которые также могут содержать другие белки.

Matrix Protein - обзор

5 Сборка вирусных матричных белков

Матричные белки вирусов РНК с отрицательной цепью первоначально синтезируются как растворимые белки в цитоплазме, которые затем разделяются на мембраны в различной степени, в зависимости от типа вируса. вирус и экспериментальные условия.Для большинства вирусов ассоциация с мембранами происходит независимо от других вирусных компонентов и, вероятно, включает взаимодействие с липидами мембран. Для некоторых вирусов, таких как VSV, вирус Эбола и вирус гриппа, было показано, что отрицательно заряженные фосфолипиды способствуют взаимодействию вирусного матричного белка с мембранами (Ruigrok, Barge, et al., 2000; Ruigrok, Schoehn, et al., 2000; Заковски, Петри и Вагнер, 1981). Поскольку эти липиды обогащены на цитоплазматической поверхности плазматических мембран хозяина, это приводит к преимущественной локализации этих матричных белков на плазматической мембране.

Подобно вирусным белкам оболочки, вирусные матричные белки, вероятно, не распределены случайным образом в плазматической мембране хозяина, а вместо этого организованы в микродомены мембраны. В случае VSV и вируса гриппа микродомены, содержащие матриксный белок, в плазматических мембранах хозяина были продемонстрированы путем анализа кластеризации частиц иммунного золота на электронных микрофотографиях (Chen, Leser, Jackson, & Lamb, 2008; Swinteck & Lyles, 2008). В некоторых случаях, например, вирусом кори (Pohl, Duprex, Krohne, Rima, & Schneider-Schaulies, 2007) и вирусом Эбола (Bavari et al., 2002; Panchal et al., 2003), вирусные матричные белки присутствуют в устойчивых к детергентам липидных рафтах при экспрессии в отсутствие других вирусных белков. Однако в других случаях, таких как вирус гриппа (Ali, Avalos, Ponimaskin, & Nayak, 2000), вирус Сендай (Ali & Nayak, 2000) и респираторно-синцитиальный вирус (Henderson, Murray, & Yeo, 2002), коэкспрессия Гликопротеины вирусной оболочки необходимы для того, чтобы белки вирусного матрикса присутствовали во фракциях мембран, устойчивых к детергентам, предположительно в тех же микродоменах, которые содержат гликопротеины оболочки.В самом деле, совместная локализация белка M1 вируса гриппа в микродоменах плазматической мембраны хозяина, содержащих HA, была продемонстрирована анализом иммуноэлектронных микрофотографий (Chen et al., 2008). Однако аналогичный анализ VSV-инфицированных клеток показал, что M-белок и G-белок находятся в отдельных мембранных микродоменах, и единственное место, где они колокализовались, было на сайтах почкования вируса (Swinteck & Lyles, 2008). Точно так же матричный (Z) белок аренавируса Junin не колокализуется с GPC-содержащими микродоменами (Agnihothram et al., 2009). Как и в случае образования вирусного псевдотипа, присутствие вирусных белков в отдельных мембранных микродоменах, которые собираются вместе в сайтах почкования вируса, подразумевает своего рода движущую силу для кластеризации или слияния этих мембранных микродоменов.

Большинство учебных моделей сборки вирусов постулируют прямое взаимодействие между вирусными матриксными белками и цитоплазматическими доменами гликопротеинов вирусной оболочки как движущую силу сборки вируса. Однако биохимически продемонстрировать такое прямое взаимодействие было очень сложно.Например, большинство гликопротеинов оболочки легко солюбилизируются из вирионов, свободных от матричных белков, даже с помощью самых мягких моющих средств, что исключает использование типичных подходов иммунопреципитации или аффинного осаждения («выпадающего»). Таким образом, если такое взаимодействие существует, вероятно, оно будет иметь низкое сродство. В экспериментах в нашей лаборатории (Lyles, McKenzie, & Parce, 1992) было показано, что M-белок и G-белок, очищенные от VSV в присутствии детергента, взаимодействуют друг с другом с умеренным сродством ( K d ∼ 20 нМ ) и относительно быстрая скорость уравновешивания ( т 1/2 ∼ 5–10 мин).Это взаимодействие проявлялось в стабилизации тримеров G-белка в присутствии M-белка, что было проанализировано с помощью флуоресцентной спектроскопии. Однако нельзя было окончательно продемонстрировать, что стабилизация тримеров G-белка происходила из-за взаимодействия M-белка с цитоплазматическим доменом G-белка или, альтернативно, с мицеллами детергента, связанными с трансмембранным доменом. Были сообщения о взаимодействии белков вирусного матрикса с гликопротеинами оболочки в клеточных лизатах с использованием коиммунопреципитации или аналогичных подходов (например,г., Capul, de la Torre, & Buchmeier, 2011; Капул и др., 2007; Пантуа, МакГиннес, Пиплз и Моррисон, 2006 г.). Однако эти результаты могут быть связаны с большими поливалентными комплексами, которые также могут содержать другие белки.

ячейка | Определение, типы, функции, диаграмма, деление, теория и факты

Подумайте, как одноклеточный организм содержит необходимые структуры для питания, роста и воспроизводства.

Клетки - это основные единицы жизни.

Encyclopædia Britannica, Inc. См. Все видео по этой статье

Клетка , в биологии, основная мембраносвязанная единица, которая содержит основные молекулы жизни и из которых состоят все живые существа. Одна клетка сама по себе часто является целостным организмом, например бактерией или дрожжами. По мере созревания другие клетки приобретают особые функции. Эти клетки взаимодействуют с другими специализированными клетками и становятся строительными блоками больших многоклеточных организмов, таких как люди и другие животные. Хотя клетки намного больше атомов, они все же очень маленькие.Самые маленькие из известных клеток - это группа крошечных бактерий, называемых микоплазмами; некоторые из этих одноклеточных организмов представляют собой сферы диаметром всего 0,2 мкм (1 мкм = примерно 0,000039 дюйма) с общей массой 10 –14 граммов, что равно 8 000 000 000 атомов водорода. Клетки человека обычно имеют массу в 400 000 раз больше, чем масса отдельной бактерии микоплазмы, но даже человеческие клетки имеют только около 20 мкм в поперечнике. Для того, чтобы закрыть булавочную головку, потребуется лист из примерно 10 000 человеческих клеток, а каждый человеческий организм состоит из более чем 30 000 000 000 000 клеток.

животная клетка

Основные структуры животной клетки Цитоплазма окружает специализированные структуры клетки, или органеллы. Рибосомы, места синтеза белка, находятся в цитоплазме в свободном состоянии или прикреплены к эндоплазматическому ретикулуму, через который материалы транспортируются по клетке. Энергия, необходимая клетке, выделяется митохондриями. Комплекс Гольджи, стопки сплющенных мешочков, обрабатывает и упаковывает материалы, которые должны быть выпущены из клетки в секреторные пузырьки.Пищеварительные ферменты содержатся в лизосомах. Пероксисомы содержат ферменты, выводящие токсины из опасных веществ. Центросома содержит центриоли, которые играют роль в делении клеток. Микроворсинки - это пальцевидные отростки, обнаруженные на определенных клетках. Реснички, похожие на волосы структуры, которые выходят на поверхность многих клеток, могут создавать движение окружающей жидкости. Ядерная оболочка, двойная мембрана, окружающая ядро, содержит поры, которые контролируют движение веществ в нуклеоплазму и из нее.Хроматин, комбинация ДНК и белков, образующих хромосомы, составляет большую часть нуклеоплазмы. Плотное ядрышко - место производства рибосом.

© Merriam-Webster Inc.

Популярные вопросы

Что такое ячейка?

Клетка - это масса цитоплазмы, которая снаружи связана клеточной мембраной. Обычно микроскопические по размеру клетки представляют собой мельчайшие структурные единицы живого вещества и составляют все живое. Большинство клеток имеют одно или несколько ядер и других органелл, которые выполняют множество задач.Некоторые отдельные клетки представляют собой полноценные организмы, такие как бактерии или дрожжи. Другие представляют собой специализированные строительные блоки многоклеточных организмов, таких как растения и животные.

Что такое клеточная теория?

Теория клетки утверждает, что клетка является фундаментальной структурной и функциональной единицей живого вещества. В 1839 году немецкий физиолог Теодор Шванн и немецкий ботаник Матиас Шлейден заявили, что клетки являются «элементарными частицами организмов» как у растений, так и у животных, и признали, что одни организмы одноклеточные, а другие многоклеточные.Эта теория ознаменовала собой большой концептуальный прогресс в биологии и привела к возобновлению внимания к жизненным процессам, происходящим в клетках.

Что делают клеточные мембраны?

Клеточная мембрана окружает каждую живую клетку и отделяет клетку от окружающей среды. Он служит барьером, препятствующим проникновению содержимого клетки и проникновению нежелательных веществ. Он также функционирует как ворота для активного и пассивного перемещения основных питательных веществ в клетку и вывод продуктов жизнедеятельности из нее.Определенные белки клеточной мембраны участвуют в межклеточной коммуникации и помогают клетке реагировать на изменения в окружающей среде.

В этой статье клетка рассматривается как отдельная единица и как составляющая часть более крупного организма. Как отдельная единица, клетка способна метаболизировать свои собственные питательные вещества, синтезировать многие типы молекул, обеспечивать свою собственную энергию и воспроизводить себя, чтобы производить последующие поколения. Его можно рассматривать как закрытый сосуд, внутри которого одновременно происходят бесчисленные химические реакции.Эти реакции находятся под очень точным контролем, поэтому они способствуют жизни и размножению клетки. В многоклеточном организме клетки становятся специализированными для выполнения различных функций в процессе дифференцировки. Для этого каждая ячейка поддерживает постоянную связь со своими соседями. Получая питательные вещества из окружающей среды и выбрасывая отходы, она прикрепляется к другим клеткам и взаимодействует с ними. Совместные сборки подобных клеток образуют ткани, а сотрудничество между тканями, в свою очередь, формирует органы, которые выполняют функции, необходимые для поддержания жизни организма.

Особое внимание в этой статье уделяется клеткам животных, с некоторым обсуждением процессов синтеза энергии и внеклеточных компонентов, свойственных растениям. (Для подробного обсуждения биохимии растительных клеток, см. Фотосинтез . Для полной обработки генетических событий в ядре клетки, см. Наследственность .)

Брюс М. Альбертс

Природа и функции клеток

A клетка окружена плазматической мембраной, которая образует селективный барьер, который позволяет питательным веществам проникать, а продукты жизнедеятельности - выходить.Внутренняя часть клетки состоит из множества специализированных отсеков или органелл, каждый из которых окружен отдельной мембраной. Одна из основных органелл, ядро, содержит генетическую информацию, необходимую для роста и размножения клеток. Каждая клетка содержит только одно ядро, тогда как другие типы органелл присутствуют в множестве копий в клеточном содержимом или цитоплазме. Органеллы включают митохондрии, которые отвечают за передачу энергии, необходимую для выживания клеток; лизосомы, которые переваривают нежелательные материалы внутри клетки; а также эндоплазматический ретикулум и аппарат Гольджи, которые играют важную роль во внутренней организации клетки, синтезируя выбранные молекулы, а затем обрабатывая, сортируя и направляя их в нужные места.Кроме того, клетки растений содержат хлоропласты, которые отвечают за фотосинтез, благодаря чему энергия солнечного света используется для преобразования молекул углекислого газа (CO 2 ) и воды (H 2 O) в углеводы. Между всеми этими органеллами есть пространство в цитоплазме, называемое цитозолем. Цитозоль содержит организованный каркас из волокнистых молекул, составляющих цитоскелет, который придает клетке ее форму, позволяет органеллам перемещаться внутри клетки и обеспечивает механизм, с помощью которого сама клетка может двигаться.Цитозоль также содержит более 10 000 различных видов молекул, которые участвуют в клеточном биосинтезе, процессе создания больших биологических молекул из маленьких.

клеток

Клетки животных и растений содержат мембраносвязанные органеллы, включая отдельное ядро. Напротив, бактериальные клетки не содержат органелл.

Британская энциклопедия, Inc. Получите подписку Britannica Premium и получите доступ к эксклюзивному контенту. Подпишитесь сейчас

Специализированные органеллы характерны для клеток организмов, известных как эукариоты.Напротив, клетки организмов, известных как прокариоты, не содержат органелл и обычно меньше эукариотических клеток. Однако все клетки имеют сильное сходство в биохимических функциях.

эукариотическая клетка

Рисунок эукариотической клетки в разрезе.

Encyclopædia Britannica, Inc.

Молекулы клеток

Понять, как клеточные мембраны регулируют потребление пищи и отходы и как клеточные стенки обеспечивают защиту

Клетки поглощают молекулы через свои плазматические мембраны.

Encyclopædia Britannica, Inc. Посмотреть все видео к этой статье

Клетки содержат особый набор молекул, которые заключены в мембрану. Эти молекулы дают клеткам возможность расти и воспроизводиться. Общий процесс клеточного воспроизводства происходит в два этапа: рост клеток и деление клеток. Во время роста клетки клетки поглощают определенные молекулы из своего окружения, избирательно перенося их через клеточную мембрану. Попав внутрь клетки, эти молекулы подвергаются действию узкоспециализированных, больших, тщательно свернутых молекул, называемых ферментами.Ферменты действуют как катализаторы, связываясь с проглоченными молекулами и регулируя скорость их химического изменения. Эти химические изменения делают молекулы более полезными для клетки. В отличие от проглоченных молекул, катализаторы сами химически не изменяются во время реакции, что позволяет одному катализатору регулировать конкретную химическую реакцию во многих молекулах.

Биологические катализаторы создают цепочки реакций. Другими словами, молекула, химически преобразованная одним катализатором, служит исходным материалом или субстратом для второго катализатора и так далее.Таким образом, катализаторы используют небольшие молекулы, принесенные в клетку из внешней среды, для создания все более сложных продуктов реакции. Эти продукты используются для роста клеток и воспроизведения генетического материала. После копирования генетического материала и наличия достаточного количества молекул для поддержки деления клетки клетка делится, образуя две дочерние клетки. Через множество таких циклов клеточного роста и деления каждая родительская клетка может дать начало миллионам дочерних клеток, в процессе преобразования больших количеств неодушевленного вещества в биологически активные молекулы.

Сравнительный анализ белков вирусного матрикса с использованием предикторов нарушения | Журнал вирусологии

  • 1.

    Тернер Б.Г., Саммерс М.Ф .: Структурная биология ВИЧ. J Mol Biol 1999, 285: 1-32. 10.1006 / jmbi.1998.2354

    CAS Статья PubMed Google Scholar

  • 2.

    Cannon PM, Matthews S, Clark N, Byles ED, Iourin O, Hockley DJ, Kingsman SM, Kingsman AJ: Структурно-функциональные исследования матричного белка вируса иммунодефицита человека типа 1, стр. 17. J Virol 1997, 71: 3474-3483.

    PubMed Central CAS PubMed Google Scholar

  • 3.

    Dorfman T, Mammano F, Haseltine WA, Gottlinger HG: Роль матричного белка в ассоциации вирионов гликопротеина оболочки вируса иммунодефицита человека 1 типа. J Virol 1994, 68: 1689-1696.

    PubMed Central CAS PubMed Google Scholar

  • 4.

    Harris A, Sha B, Luo M: Структурное сходство между матричным белком M1 вируса гриппа и матриксом вируса иммунодефицита человека и белками капсида: эволюционная связь между вирусами с отрицательной цепью РНК и ретровирусами. J Gen Virol 1999, 80 (Pt 4): 863-869.

    CAS Статья PubMed Google Scholar

  • 5.

    Hearps AC, Jans DA: Регулирование функций матричного белка ВИЧ-1. Ретровирусы AIDS Res Hum 2007, 23: 341-346. 10.1089 / aid.2006.0108

    CAS Статья PubMed Google Scholar

  • 6.

    Lyles DS, McKenzie M, Parce JW: Субъединичные взаимодействия гликопротеина оболочки вируса везикулярного стоматита, стабилизированные путем связывания с вирусным матриксным белком. J Virol 1992, 66: 349-358.

    PubMed Central CAS PubMed Google Scholar

  • 7.

    Clements JE, Zink MC: Молекулярная биология и патогенез лентивирусных инфекций животных. Clin Microbiol Rev 1996, 9: 100-117.

    PubMed Central CAS PubMed Google Scholar

  • 8.

    Goudsmit J: Вирусный секс: природа СПИДа. Oxford University Press, Нью-Йорк; 1997.

    Google Scholar

  • 9.

    Leroux C, Cadore JL, Montelaro RC: Вирус инфекционной анемии лошадей (EIAV): о чем нам должен сказать деревенский родственник ВИЧ? Vet Res 2004, 35: 485-512.10.1051 / ветрес: 2004020

    CAS Статья PubMed Google Scholar

  • 10.

    Marx PA, Li Y, Lerche NW, Sutjipto S, Gettie A, Yee JA, Brotman BH, Prince AM, Hanson A, Webster RG, et al .: Выделение вируса иммунодефицита обезьян, связанного с к вирусу иммунодефицита человека типа 2 от западноафриканского домашнего животного сажистого мангабея. J Virol 1991, 65: 4480-4485.

    PubMed Central CAS PubMed Google Scholar

  • 11.

    Jurriaans S, van Gemen B, Weverling GJ, van Strijp D, Nara P, Coutinho R, Koot M, Schuitemaker H, Goudsmit J: Естественная история инфекции ВИЧ-1: вирусная нагрузка и независимые от фенотипа вируса детерминанты клинического течения ? Вирусология 1994, 204: 223-233. 10.1006 / viro.1994.1526

    CAS Статья PubMed Google Scholar

  • 12.

    Морган Д., Маэ С., Майянджа Б., Уитворт Дж. А: Прогрессирование симптоматического заболевания у людей, инфицированных ВИЧ-1, в сельских районах Уганды: проспективное когортное исследование. BMJ 2002, 324: 193-196. 10.1136 / bmj.324.7331.193

    PubMed Central Статья PubMed Google Scholar

  • 13.

    Чен З, Телфер П., Рид П., Чжан Л., Гетти А., Хо Д. Д., Маркс П. А.: Выделение и характеристика первого вируса иммунодефицита обезьян из одичавшего сажистого мангабея (Cercocebus atys) в Западной Африке. J Med Primatol 1995, 24: 108-115.

    CAS Статья PubMed Google Scholar

  • 14.

    Apetrei C, Lerche NW, Pandrea I, Gormus B, Silvestri G, Kaur A, Robertson DL, Hardcastle J, Lackner AA, Marx PA: Эксперименты Куру вызвали появление патогенного вируса SIVmac. AIDS 2006, 20: 317-321.

    Артикул PubMed Google Scholar

  • 15.

    Бейрер C: Потребители инъекционных наркотиков и испытания вакцины против ВИЧ: что говорит наука? AIDScience 2002, 2: 1-6.

    Google Scholar

  • 16.

    Бертон Д.Р., Стэнфилд Р.Л., Уилсон И.А.: Антитело против ВИЧ в столкновении эволюционных титанов. Proc Natl Acad Sci USA 2005, 102: 14943-14948. 10.1073 / pnas.0505126102

    PubMed Central CAS Статья PubMed Google Scholar

  • 17.

    МакМайкл А., Мвау М., Ханке Т: Разработка и тесты вакцины против ВИЧ. Br Med Bull 2002, 62: 87-98. 10.1093 / bmb / 62.1.87

    Артикул PubMed Google Scholar

  • 18.

    Burton DR: Антитела, вирусы и вакцины. Nat Rev Immunol 2002, 2: 706-713. 10.1038 / nri891

    CAS Статья PubMed Google Scholar

  • 19.

    Wright PE, Dyson HJ: Внутренне неструктурированные белки: переоценка парадигмы структура-функция белка. J Mol Biol 1999, 293: 321-331. 10.1006 / jmbi.1999.3110

    CAS Статья PubMed Google Scholar

  • 20.

    Tompa P: Внутренне неструктурированные белки. Trends Biochem Sci 2002, 27: 527-533. 10.1016 / S0968-0004 (02) 02169-2

    CAS Статья PubMed Google Scholar

  • 21.

    Уверский В.Н., Гиллеспи Дж. Р., Финк А.Л .: Почему «нативно развернутые» белки не структурируются в физиологических условиях? Белки 2000, 41: 415-427. 10.1002 / 1097-0134 (20001115) 41: 3 <415 :: AID-PROT130> 3.0.CO; 2-7

    CAS Статья PubMed Google Scholar

  • 22.

    Weinreb PH, Zhen W., Poon AW, Conway KA, Lansbury PT Jr: NACP, белок, участвующий в болезни Альцгеймера и обучении, является естественным. Биохимия 1996, 35: 13709-13715. 10.1021 / bi961799n

    CAS Статья PubMed Google Scholar

  • 23.

    Daughdrill GW, Pielak GJ, Uversky VN, Cortese MS, Dunker AK: Нативно неупорядоченные белки. В Справочнике по свертыванию белков . Под редакцией: Бюхнер Дж., Кифхабер Т. Вили-ВЧ, Verlag GmbH & Co. KGaA, Вайнхайм, Германия; 2005: 271-353.

    Google Scholar

  • 24.

    Dunker AK, Oldfield CJ, Meng J, Romero P, Yang JY, Cheng JW, Vacic V, Obradovic Z, Uversky VN: Десятилетие разворотовки: обновленная информация о внутренне неупорядоченных белках. BMC Genomics 2008, 9: S1. 10.1186 / 1471-2164-9-S2-S1

    Артикул Google Scholar

  • 25.

    Уверский В.Н., Олдфилд С.Дж., Дункер А.К.: Отображение вашего идентификатора: внутреннего расстройства в качестве идентификатора для распознавания, регуляции и передачи сигналов в клетке. J Mol Recognit 2005, 18: 343-384. 10.1002 / jmr.747

    CAS Статья PubMed Google Scholar

  • 26.

    Xie H, Vucetic S, Iakoucheva LM, Oldfield CJ, Dunker AK, Obradovic Z, Uversky VN: Функциональная антология внутреннего расстройства. 3. Лиганды, посттрансляционные модификации и заболевания, связанные с внутренне неупорядоченными белками. J Proteome Res 2007, 6: 1917-1932.

    PubMed Central CAS Статья PubMed Google Scholar

  • 27.

    Вучетич С., Се Х., Якучева Л.М., Олдфилд С.Дж., Дункер А.К., Обрадович З., Уверский В.Н.: Функциональная антология внутреннего расстройства. 2. Клеточные компоненты, домены, технические термины, процессы развития и разнообразие кодирующих последовательностей коррелировали с длинными неупорядоченными регионами. J Proteome Res 2007, 6: 1899-1916.

    PubMed Central CAS Статья PubMed Google Scholar

  • 28.

    Xie H, Vucetic S, Iakoucheva LM, Oldfield CJ, Dunker AK, Uversky VN, Obradovic Z: Функциональная антология внутреннего расстройства. 1. Биологические процессы и функции белков с длинными неупорядоченными участками. J Proteome Res 2007, 6: 1882-1898.

    PubMed Central CAS Статья PubMed Google Scholar

  • 29.

    Дункер А.К., Браун С.Дж., Лоусон Дж.Д., Якучева Л.М., Обрадович З .: Внутреннее нарушение и функция белка. Биохимия 2002, 41: 6573-6582. 10.1021 / bi012159 +

    CAS Статья PubMed Google Scholar

  • 30.

    Дункер А.К., Лоусон Д.Д., Браун Си-Джей, Уильямс Р.М., Ромеро П., О Дж. С., Олдфилд Си-Джей, Кэмпен А.М., Рэтлифф С.М., Хиппс К.В., Аусио Дж., Ниссен М.С., Ривз Р., Канг К., Киссинджер К.Р. , Бейли Р.В., Гризволд М.Д., Чиу В., Гарнер Е.К., Обрадович Z: Внутренне неупорядоченный белок. Модель J Mol Graph 2001, 19: 26-59. 10.1016 / S1093-3263 (00) 00138-8

    CAS Статья PubMed Google Scholar

  • 31.

    Dyson HJ, Wright PE: Внутренне неструктурированные белки и их функции. Nat Rev Mol Cell Biol 2005, 6: 197-208. 10.1038 / nrm1589

    CAS Статья PubMed Google Scholar

  • 32.

    Sickmeier M, Hamilton JA, LeGall T, Vacic V, Cortese MS, Tantos A, Szabo B, Tompa P, Chen J, Uversky VN, Obradovic Z, Dunker AK: DisProt: База данных неупорядоченных белков. Nucleic Acids Res 2007, 35: D786-793. 10.1093 / nar / gkl893

    PubMed Central CAS Статья PubMed Google Scholar

  • 33.

    Romero P, Obradovic Z, Li X, Garner EC, Brown CJ, Dunker AK: Сложность последовательности неупорядоченного белка. Белки 2001, 42: 38-48. 10.1002 / 1097-0134 (20010101) 42: 1 <38 :: AID-PROT50> 3.0.CO; 2-3

    CAS Статья PubMed Google Scholar

  • 34.

    Vucetic S, Brown CJ, Dunker AK, Obradovic Z: Вкус белкового расстройства. Белки 2003, 52: ​​ 573-584. 10.1002 / prot.10437

    CAS Статья PubMed Google Scholar

  • 35.

    Гарнер Е., Ромеро П., Дункер А. К., Браун С., Обрадович З .: Предсказание областей связывания в неупорядоченных белках. Genome Inform Ser Workshop Genome Inform 1999, 10: 41-50.

    CAS PubMed Google Scholar

  • 36.

    Obradovic Z, Peng K, Vucetic S, Radivojac P, Brown CJ, Dunker AK: Прогнозирование внутреннего нарушения по аминокислотной последовательности. Белки 2003, 53 (Дополнение 6): 566-572.10.1002 / prot.10532

    CAS Статья PubMed Google Scholar

  • 37.

    Дункер А.К., Гарнер Э., Гийо С., Ромеро П., Альбрехт К., Харт Дж., Обрадович З., Киссинджер С., Виллафранка Дж. Э .: Белковые расстройства и эволюция молекулярного распознавания: теория, прогнозы и наблюдения. Pac Symp Biocomput 1998, 473-484.

    Google Scholar

  • 38.

    Romero P, Obradovic Z, Kissinger CR, Villafranca JE, Garner E, Guilliot S, Dunker AK: Тысячи белков, вероятно, имеют давно неупорядоченные области. Pac Symp Biocomput 1998, 437-448.

    Google Scholar

  • 39.

    Oldfield CJ, Cheng Y, Cortese MS, Brown CJ, Uversky VN, Dunker AK: Сравнение и комбинирование предикторов наиболее неупорядоченных белков. Биохимия 2005, 44: 1989-2000.10.1021 / bi047993o

    CAS Статья PubMed Google Scholar

  • 40.

    Cheng Y, Oldfield CJ, Meng J, Romero P, Uversky VN, Dunker AK: Выявление признаков молекулярного распознавания, образующих альфа-спираль, с выравниванием последовательностей между видами. Биохимия 2007, 46: 13468-13477. 10.1021 / bi7012273

    PubMed Central CAS Статья PubMed Google Scholar

  • 41.

    Goh GK-M, Dunker AK, Uversky VN: Набор инструментов для анализа внутренних нарушений белков для сравнительного анализа вирусных белков. BMC Genomics 2008, 9: S4. 10.1186 / 1471-2164-9-S2-S4

    PubMed Central Статья PubMed Google Scholar

  • 42.

    Radivojac P, Obradovic Z, Smith DK, Zhu G, Vucetic S, Brown CJ, Lawson JD, Dunker AK: Гибкость белка и внутреннее нарушение. Protein Sci 2004, 13: 71-80.10.1110 / пс. 03128904

    PubMed Central CAS Статья PubMed Google Scholar

  • 43.

    Дункер А.К., Кортезе М.С., Ромеро П., Якучева Л.М., Уверский В.Н.: Сетки гибкие. Роль внутреннего расстройства в сетях взаимодействия белков. FEBS J 2005, 272: 5129-5148. 10.1111 / j.1742-4658.2005.04948.x

    CAS Статья PubMed Google Scholar

  • 44.

    Уверский ВН: Что значит быть изначально развернутым? Eur J Biochem 2002, 269: 2-12. 10.1046 / j.0014-2956.2001.02649.x

    CAS Статья PubMed Google Scholar

  • 45.

    Уверский В.Н.: Естественно развернутые белки: точка, в которой биология ждет физику. Protein Sci 2002, 11: 739-756. 10.1110 / пс 4210102

    PubMed Central CAS Статья PubMed Google Scholar

  • 46.

    Уверский В.Н.: Возвращение к фолдингу белков. Полипептидная цепь на перекрестке складывания-неправильного складывания-несгибания: куда идти? Cell Mol Life Sci 2003, 60: 1852-1871. 10.1007 / s00018-003-3096-6

    CAS Статья PubMed Google Scholar

  • 47.

    Hulskotte EG, Geretti AM, Osterhaus AD: На пути к вакцине против ВИЧ-1: уроки исследований на моделях макак. Vaccine 1998, 16: 904-915.10.1016 / S0264-410X (97) 00292-2

    CAS Статья PubMed Google Scholar

  • 48.

    Vigerust DJ, Shepherd VL: Гликозилирование вируса: роль в вирулентности и иммунных взаимодействиях. Trends Microbiol 2007, 15: 211-218. 10.1016 / j.tim.2007.03.003

    CAS Статья PubMed Google Scholar

  • 49.

    Чакраварти Дж., Мехта Х., Парех А., Аттили С.В., Агравал Н.Р., Сингх С.П., Сундар С. Исследование клинико-эпидемиологического профиля пациентов с ВИЧ в восточной Индии. J Assoc Physitors India 2006, 54: 854-857.

    CAS PubMed Google Scholar

  • 50.

    Chernajovsky Y, Layward L, Lemoine N: Борьба с раком с помощью онколитических вирусов. BMJ 2006, 332: 170-172. 10.1136 / bmj.332.7534.170

    PubMed Central Статья PubMed Google Scholar

  • 51.

    Берман Х.М., Вестбрук Дж., Фенг З., Гиллиланд Дж., Бхат Т.Н., Вайссиг Х., Шиндялов И.Н., Борн П.Е .: Банк данных по белкам. Nucleic Acids Res 2000, 28: 235-242. 10.1093 / nar / 28.1.235

    PubMed Central CAS Статья PubMed Google Scholar

  • 52.

    Пратт П.Дж., Адамски Дж.Дж.: Концепции управления базами данных . 4-е издание. Thomson Course Technology, Бостон, Массачусетс; 2002.

    Google Scholar

  • 53.

    Li X, Romero P, Rani M, Dunker AK, Obradovic Z: Прогнозирование нарушения белка для N-, C- и внутренних областей. Genome Inform Ser Workshop Genome Inform 1999, 10: 30-40.

    CAS PubMed Google Scholar

  • 54.

    Herráez A: Биомолекулы в компьютере: Jmol спешит на помощь. Биохимия и молекулярная биология Образование 2006, 34: 255-261.10.1002 / bmb.2006.494034042644

    Артикул PubMed Google Scholar

  • Нативная структура собранного матричного белка 1 вируса гриппа A

  • 1.

    Россман, Дж. С. и Лэмб, Р. А. Сборка и почкование вируса гриппа. Вирусология 411 , 229–236 (2011).

    CAS PubMed PubMed Central Google Scholar

  • 2.

    Эльстер, К., Larsen, K., Gagnon, J., Ruigrok, R. W. & Baudin, F. Белок M1 вируса гриппа связывается с РНК через сигнал ядерной локализации. Дж. Ген. Вирол . 78 , 1589–1596 (1997).

    CAS PubMed Google Scholar

  • 3.

    Noton, S. L. et al. Идентификация доменов матричного белка M1 вируса гриппа A, необходимых для связывания NP, олигомеризации и включения в вирионы. J. Gen.Вирол . 88 , 2280–2290 (2007).

    CAS PubMed PubMed Central Google Scholar

  • 4.

    Chen, B.J., Takeda, M. & Lamb, R.A. Гемагглютинин вируса гриппа (подтип h4) требует пальмитоилирования его цитоплазматического хвоста для сборки: белки M1 двух подтипов различаются по своей способности поддерживать сборку. Дж. Вирол . 79 , 13673–13684 (2005).

    CAS PubMed PubMed Central Google Scholar

  • 5.

    Zhang, J., Pekosz, A. & Lamb, R.A. Сборка вируса гриппа и микродомены липидного рафта: роль цитоплазматических хвостов гликопротеинов шипа. Дж. Вирол . 74 , 4634–4644 (2000).

    CAS PubMed PubMed Central Google Scholar

  • 6.

    Chu, C.M., Dawson, I.M. и Elford, W.J. Нитевидные формы, ассоциированные с недавно выделенным вирусом гриппа. Ланцет 253 , 602 (1949).

    Google Scholar

  • 7.

    Мосли В. М. и Вайкофф Р. В. Г. Электронная микрография вируса гриппа. Природа 157 , 263 (1946).

    ADS CAS PubMed Google Scholar

  • 8.

    Ригли Н.Г. Электронная микроскопия вируса гриппа. Br. Med. Бык . 35 , 35–38 (1979).

    CAS PubMed Google Scholar

  • 9.

    Ruigrok, R. W., Calder, L. J. & Wharton, S. A. Электронная микроскопия субмембранной структуры вируса гриппа. Вирусология 173 , 311–316 (1989).

    CAS PubMed Google Scholar

  • 10.

    Нермут М.В. Дальнейшие исследования тонкой структуры вируса гриппа. Дж. Ген. Вирол . 17 , 317–331 (1972).

    CAS PubMed Google Scholar

  • 11.

    Fontana, J. & Steven, A.C. При низком pH матричный белок M1 вируса гриппа претерпевает конформационные изменения перед диссоциацией от мембраны. Дж. Вирол . 87 , 5621–5628 (2013).

    CAS PubMed PubMed Central Google Scholar

  • 12.

    Ша, Б. и Луо, М. Структура бифункционального белка, связывающего мембрану и РНК, матричного белка М1 вируса гриппа. Нат. Struct. Биол . 4 , 239–244 (1997).

    CAS PubMed Google Scholar

  • 13.

    Arzt, S. et al. Объединенные результаты исследований раствора интактного белка M1 вируса гриппа и новой кристаллической формы его N-концевого домена показывают, что M1 представляет собой удлиненный мономер. Вирусология 279 , 439–446 (2001).

    CAS PubMed Google Scholar

  • 14.

    Harris, A., Forouhar, F., Qiu, S., Sha, B. & Luo, M. Кристаллическая структура матричного белка M1 гриппа при нейтральном pH: границы раздела белков M1 – M1 могут вращаться в олигомерных структурах M1. Virology 289 , 34–44 (2001).

    CAS PubMed Google Scholar

  • 15.

    Zhang, W. et al. Кристаллическая структура матричного белка ортомиксовируса раскрывает механизмы самополимеризации и мембранной ассоциации. Proc. Natl Acad. Sci. США 114 , 8550–8555 (2017).

    CAS PubMed Google Scholar

  • 16.

    Сугита Ю., Нода Т., Сагара Х. и Каваока Ю. Ультрацентрифугирование деформирует нефиксированные вирионы гриппа А. Дж. Ген. Вирол . 92 , 2485–2493 (2011).

    CAS PubMed PubMed Central Google Scholar

  • 17.

    Виджаякришнан, С.и другие. Криотомография зарождающегося вируса гриппа A выявляет нити различной морфологии, которые в большинстве случаев не имеют генома на своем дистальном конце. PLoS Pathog . 9 , e1003413 (2013).

    CAS PubMed PubMed Central Google Scholar

  • 18.

    Кальдер Л. Дж., Василевски С., Берриман Дж. А. и Розенталь П. Б. Структурная организация вируса нитчатого гриппа А. Proc. Natl Acad.Sci. США 107 , 10685–10690 (2010).

    ADS CAS PubMed Google Scholar

  • 19.

    Chlanda, P. et al. Структурный анализ роли белков, ассоциированных с мембраной вируса гриппа А, в сборке и морфологии. Дж. Вирол . 89 , 8957–8966 (2015).

    CAS PubMed PubMed Central Google Scholar

  • 20.

    Ruigrok, R. W. H. et al. Мембранное взаимодействие белка M1 вируса гриппа. Вирусология 267 , 289–298 (2000).

    CAS PubMed Google Scholar

  • 21.

    Бурмакина С. В. и Гарсия-Састре А. Исследования обратной генетики нитчатой ​​морфологии вируса гриппа А. Дж. Ген. Вирол . 84 , 517–527 (2003).

    CAS PubMed Google Scholar

  • 22.

    Elleman, C.J. и Barclay, W. S. Матричный белок M1 контролирует нитчатый фенотип вируса гриппа А. Вирусология 321 , 144–153 (2004).

    CAS PubMed Google Scholar

  • 23.

    Burleigh, L.M., Calder, L.J., Skehel, J. J. & Steinhauer, D. A. Вирусы гриппа A с мутациями в шестом домене спирали M1 демонстрируют широкий спектр морфологических фенотипов. Дж. Вирол . 79 , 1262–1270 (2005).

    CAS PubMed PubMed Central Google Scholar

  • 24.

    Шишков А. и др. Особенности пространственной структуры матричного белка M1 вируса гриппа А в кислом растворе, имитирующем внутреннюю лизосомную среду. FEBS J . 278 , 4905–4916 (2011).

    CAS PubMed Google Scholar

  • 25.

    Chiang, M.-J. и другие. Поддержание pH-зависимой конформационной гибкости M1 имеет решающее значение для эффективной репликации вируса гриппа А. Emerg. Микробы заражают . 6 , e108 (2017).

    PubMed PubMed Central Google Scholar

  • 26.

    Dahmani, I., Ludwig, K. & Chiantia, S. Матричный белок M1 гриппа A индуцирует деформацию липидной мембраны посредством мультимеризации белка. Biosci. Репутация . 39 , BSR201 (2019).

    CAS PubMed PubMed Central Google Scholar

  • 27.

    Zhang, X. et al. Атомная модель вируса без оболочки показывает датчики pH для скоординированного процесса проникновения в клетки. Нат. Struct. Мол. Биол . 23 , 74–80 (2016).

    CAS PubMed Google Scholar

  • 28.

    Li, Z. & Blissard, G.W. Autographa californica белок GP64 множественного нуклеополиэдровируса: роль остатков гистидина в запуске слияния мембран и расширения пор слияния. Дж. Вирол . 85 , 12492–12504 (2011).

    CAS PubMed PubMed Central Google Scholar

  • 29.

    Колдер, Л. Дж. И Розенталь, П. Б. Криомикроскопия обеспечивает структурные снимки слияния мембран вируса гриппа. Нат. Struct.Мол. Биол . 23 , 853–858 (2016).

    CAS PubMed PubMed Central Google Scholar

  • 30.

    Gui, L., Ebner, J. L., Mileant, A., Williams, J. A. & Lee, K. K. Визуализация и секвенирование ремоделирования мембран, ведущих к слиянию вируса гриппа. Дж. Вирол . 90 , 6948–6962 (2016).

    CAS PubMed PubMed Central Google Scholar

  • 31.

    Мартинес-Собридо, Л. и Гарсия-Састре, А. Создание рекомбинантного вируса гриппа из плазмидной ДНК. J. Vis. Опыт . 42 , 2057 (2010).

    Google Scholar

  • 32.

    Tobita, K., Sugiura, A., Enomote, C. & Furuyama, M. Анализ зубного налета и первичное выделение вирусов гриппа A в установленной линии клеток почек собак (MDCK) в присутствии трипсина . Med. Microbiol. Иммунол. (Berl.) 162 , 9–14 (1975).

    CAS Google Scholar

  • 33.

    Wan, W. et al. Структура и сборка нуклеокапсида вируса Эбола. Nature 551 , 394–397 (2017).

    ADS CAS PubMed PubMed Central Google Scholar

  • 34.

    Хаген, У. Дж. Х., Ван, У. и Бриггс, Дж. А. Г. Реализация схемы наклона криоэлектронной томографии, оптимизированной для усреднения субтомограмм высокого разрешения. J. Struct. Биол . 197 , 191–198 (2017).

    PubMed PubMed Central Google Scholar

  • 35.

    Мастронард, Д. Н. Автоматизированная электронно-микроскопическая томография с надежным прогнозированием движений образца. J. Struct. Биол . 152 , 36–51 (2005).

    PubMed Google Scholar

  • 36.

    Кремер, Дж. Р., Мастронарде, Д.Н. и Макинтош, Дж. Р. Компьютерная визуализация данных трехмерного изображения с использованием IMOD. J. Struct. Биол . 116 , 71–76 (1996).

    CAS PubMed Google Scholar

  • 37.

    Роху А. и Григорьев Н. CTFFIND4: быстрая и точная оценка расфокусировки по электронным микрофотографиям. J. Struct. Биол . 192 , 216–221 (2015).

    PubMed PubMed Central Google Scholar

  • 38.

    Grant, T. и Grigorieff, N. Измерение оптимальной экспозиции для крио-ЭМ одиночных частиц с использованием реконструкции ротавируса VP6 на 2,6 Å. eLife 4 , e06980 (2015).

    PubMed PubMed Central Google Scholar

  • 39.

    Turoňová, B., Schur, F. K. M., Wan, W. & Briggs, J. A. G. Эффективная коррекция 3D-CTF для криоэлектронной томографии с использованием NovaCTF улучшает разрешение усреднения субтомограмм до 3.4Å. J. Struct. Биол . 199 , 187–195 (2017).

    PubMed PubMed Central Google Scholar

  • 40.

    Pettersen, E. F. et al. UCSF Chimera - система визуализации для поисковых исследований и анализа. J. Comput. Chem . 25 , 1605–1612 (2004).

    CAS Google Scholar

  • 41.

    Förster, F., Medalia, O., Zauberman, N., Baumeister, W. & Fass, D. Структура комплекса белков оболочки ретровируса in situ изучается с помощью криоэлектронной томографии. Proc. Natl Acad. Sci. США 102 , 4729–4734 (2005).

    ADS PubMed Google Scholar

  • 42.

    Nickell, S. et al. Программный инструментарий TOM: сбор и анализ для электронной томографии. J. Struct. Биол . 149 , 227–234 (2005).

    PubMed Google Scholar

  • 43.

    Castaño-Díez, D., Kudryashev, M., Arheit, M. & Stahlberg, H. Dynamo: гибкий и удобный инструмент разработки для усреднения субтомограмм крио-ЭМ данных в высокопроизводительных вычислительных средах. J. Struct. Биол . 178 , 139–151 (2012).

    PubMed Google Scholar

  • 44.

    Ковтун О. и др. Структура ретромерного покрытия, собранного с мембраной, определена с помощью криоэлектронной томографии. Nature 561 , 561–564 (2018).

    ADS CAS PubMed PubMed Central Google Scholar

  • 45.

    Tan, Y.Z. et al. Решение проблемы предпочтительной ориентации образца в одночастичной крио-ЭМ посредством наклона. Нат. Методы 14 , 793–796 (2017).

    CAS PubMed PubMed Central Google Scholar

  • 46.

    Розенталь, П. Б. и Хендерсон, Р. Оптимальное определение ориентации частиц, абсолютной руки и потери контраста в одночастичной электронной криомикроскопии. J. Mol. Биол . 333 , 721–745 (2003).

    CAS Google Scholar

  • 47.

    Первушин, К. Влияние спектроскопии, оптимизированной для поперечной релаксации (TROSY), на ЯМР как метод структурной биологии. Q. Rev. Biophys . 33 , 161–197 (2000).

    CAS PubMed Google Scholar

  • 48.

    Delaglio, F. et al. NMRPipe: система многомерной спектральной обработки, основанная на конвейерах UNIX. J. Biomol. ЯМР 6 , 277–293 (1995).

    CAS PubMed Google Scholar

  • 49.

    Mayzel, M., Rosenlöw, J., Isaksson, L. & Orekhov, V.Y. Многомерный ЯМР с временным разрешением и неоднородной выборкой. J. Biomol. ЯМР 58 , 129–139 (2014).

    CAS PubMed PubMed Central Google Scholar

  • 50.

    Vranken, W.F. et al. Модель данных CCPN для ЯМР-спектроскопии: разработка программного обеспечения. Белки 59 , 687–696 (2005).

    CAS PubMed Google Scholar

  • 51.

    Schwarzinger, S. et al. Последовательно-зависимая коррекция химических сдвигов ЯМР случайных катушек. J. Am. Chem. Soc . 123 , 2970–2978 (2001).

    CAS PubMed Google Scholar

  • 52.

    Ферраж, Ф., Зооненс, М., Варшавски, Д. Э., Попот, Ж.-Л. И Боденхаузен, Г. Медленная диффузия макромолекулярных сборок с помощью нового метода ЯМР с градиентом импульсного поля. J. Am. Chem. Soc . 125 , 2541–2545 (2003).

    CAS PubMed Google Scholar

  • 53.

    Гарсия де ла Торре, Дж., Уэртас, М. Л. и Карраско, Б. Расчет гидродинамических свойств глобулярных белков по их структуре на атомном уровне. Biophys. J . 78 , 719–730 (2000).

    PubMed PubMed Central Google Scholar

  • 54.

    Zheng, S.Q. et al. MotionCor2: анизотропная коррекция движения, вызванного лучом, для улучшенной криоэлектронной микроскопии. Нат. Методы 14 , 331–332 (2017).

    CAS PubMed PubMed Central Google Scholar

  • 55.

    Живанов Ю.и другие. Новые средства автоматизированного определения криоЭМ структуры высокого разрешения в РЕЛИОН-3. eLife 7 , e42166 (2018).

    PubMed PubMed Central Google Scholar

  • 56.

    Desfosses, A., Ciuffa, R., Gutsche, I. & Sachse, C. SPRING - пакет обработки изображений для спиральной реконструкции на основе одной частицы из электронных криомикрофотографий. J. Struct. Биол . 185 , 15–26 (2014).

    CAS PubMed Google Scholar

  • 57.

    Zivanov, J., Nakane, T. & Scheres, S.H. W. Байесовский подход к коррекции движения, индуцированного лучом, в крио-ЭМ одночастичном анализе. IUCrJ 6 , 5–17 (2019).

    CAS PubMed PubMed Central Google Scholar

  • 58.

    He, S. & Scheres, S. H. W. Спиральная реконструкция в RELION. J. Struct. Биол . 198 , 163–176 (2017).

    CAS PubMed PubMed Central Google Scholar

  • 59.

    Эмсли П., Локамп Б., Скотт В. Г. и Коутан К. Особенности и развитие Coot. Acta Crystallogr. Д 66 , 486–501 (2010).

    CAS Google Scholar

  • 60.

    Kidmose, R. T. et al. Намдинатор - автоматическая молекулярная динамика, гибкая подгонка структурных моделей к крио-ЭМ и кристаллографическим экспериментальным картам. IUCrJ 6 , 526–531 (2019).

    CAS PubMed PubMed Central Google Scholar

  • 61.

    Afonine, P. V. et al. Уточнение в реальном пространстве в PHENIX для крио-ЭМ и кристаллографии. Acta Crystallogr. Д 74 , 531–544 (2018).

    CAS Google Scholar

  • 62.

    Barad, B.A. et al. EMRinger: модель с направленной боковой цепью и проверка карты для трехмерной криоэлектронной микроскопии. Нат. Методы 12 , 943–946 (2015).

    CAS PubMed PubMed Central Google Scholar

  • 63.

    Das, S.C. et al. Высококонсервативные остатки аргинина в положениях 76-78 матричного белка M1 вируса гриппа A играют важную роль в репликации вируса, влияя на внутриклеточную локализацию M1. Дж. Вирол . 86 , 1522–1530 (2012).

    CAS PubMed PubMed Central Google Scholar

  • 64.

    Baudin, F., Petit, I., Weissenhorn, W. & Ruigrok, R. W. Рассечение in vitro мембраны и активности связывания RNP белка M1 вируса гриппа. Вирусология 281 , 102–108 (2001).

    CAS PubMed Google Scholar

  • 65.

    Zhang, K. et al. Два полярных остатка в С-концевом домене M1 имеют решающее значение для образования вирионов гриппа А. Ячейка. Микробиол . 17 , 1583–1593 (2015).

    PubMed PubMed Central Google Scholar

  • 66.

    Wu, C. Y., Jeng, K. S. & Lai, M. M. C. SUMOylation матричного белка M1 модулирует сборку и морфогенез вируса гриппа А. Дж. Вирол . 85 , 6618–6628 (2011).

    CAS PubMed PubMed Central Google Scholar

  • Матричный белок рабдовируса растений опосредует исключение суперинфекции путем ингибирования вирусной транскрипции

    РЕЗЮМЕ

    Исключение суперинфекции (SIE) или феномен перекрестной защиты документированы для вирусов растений уже почти столетие и широко распространены среди таксономически разнообразных вирусов. но мало информации доступно о SIE вирусов РНК с отрицательной цепью растений.Здесь мы демонстрируем, что SIE вируса желтого нетто-нуклеорабдовируса сонха (SYNV) опосредуется белком вирусной матрицы (M), многофункциональным белком, участвующим в регуляции транскрипции, сборке вирионов и почковании вируса. Мы показываем, что варианты SYNV, меченные флуоресцентными белками, проявляют взаимное исключение / перекрестную защиту в растениях Nicotiana benthamiana. Временная экспрессия белка SYNV M, но не других вирусных белков, препятствовала локальным инфекциям SYNV. Кроме того, мутанты с делецией SYNV M не смогли исключить суперинфекцию SYNV дикого типа.Анализ экспрессии репортерного гена минирепликона SYNV показал, что белок М ингибирует вирусную транскрипцию. Однако мутанты М-белка с ослабленными сигналами ядерной локализации (NLS) и недостаточными ядерными взаимодействиями с нуклеокапсидным белком SYNV были неспособны подавлять транскрипцию. Более того, SYNV с мутациями M NLS обнаруживает скомпрометированный SIE против SYNV дикого типа. Исходя из этих данных, мы предполагаем, что М-белок, накапливающийся в ядрах с первичными инфекциями SYNV, либо скручивает, либо предотвращает раскручивание нуклеокапсидов, высвобождаемых суперинфицирующими вирионами SYNV, и подавляет транскрипцию суперинфицирующих геномов, тем самым предотвращая суперинфекцию.Наша модель предполагает, что белок рабдовируса М регулирует переход от репликации к сборке вирионов и делает инфицированные клетки непозволительными для вторичных инфекций.

    ВАЖНОСТЬ Исключение суперинфекции (SIE) - широко распространенное явление, при котором установленная вирусная инфекция предотвращает повторное заражение близкородственными вирусами. Понимание механизмов, управляющих SIE, не только расширит наши базовые знания о циклах вирусной инфекции, но также может привести к улучшению разработки противовирусных мер.Несмотря на важность SIE, наши знания о вирусных детерминантах SIE и способах их действия остаются ограниченными. В этом исследовании мы показываем, что SIE вируса желтой сети сонха (SYNV) опосредуется белком вирусного матрикса (M). Во время первичных инфекций накопление белка М в инфицированных ядрах приводит к свертыванию геномных нуклеокапсидов и подавлению вирусной транскрипции. Следовательно, нуклеокапсиды, выделяемые потенциальными суперинфекторами, секвестрируются и не могут инициировать новые инфекции.Наши данные предполагают, что SYNV SIE вызывается опосредованным M-белком переходом от репликации к сборке вирионов и что этот процесс предотвращает вторичные инфекции.

    ВВЕДЕНИЕ

    Исключение суперинфекции (SIE) - это широко описанный феномен вирус-вирусного взаимодействия, при котором первичная вирусная инфекция (первичный захватчик) предотвращает последующее заражение инфицированных клеток тем же или родственным вирусом (вторичный захватчик). SIE широко задокументирован для вирусов, начиная от бактериофагов (1, 2) и заканчивая вирусными патогенами млекопитающих (3–6) и вирусами растений (см. Ссылки 7 и 8).С вирусами человека и животных эксперименты SIE часто проводились in vitro с культивированными клетками, а эффекты исключения изучались в первую очередь на клеточном уровне. Было показано, что процессы проникновения контрольных вирусов влияют на SIE в вирусе саркомы Рауса, вирусе вирусной диареи крупного рогатого скота, вирусе осповакцины, вирусе гриппа человека и вирусе иммунодефицита человека (9–13). Ингибирование репликации и / или транскрипции вируса также наблюдалось во время постентарных стадий с вирусом Синдбис, вирусом гепатита С и вирусом Западного Нила (14-18).Кроме того, первичный захватчик может вмешиваться в трансляцию белка или морфогенез вторичного вируса-захватчика (16, 19).

    Феномен, механистически связанный с SIE, но проявляющийся на уровне всего растения, - это перекрестная защита у зараженных вирусом растений (7, 8). Во время перекрестной защиты растения, инокулированные мягкими изолятами или штаммами вируса, вызывают устойчивость к вторичным инфекциям у более тяжелых изолятов, существующих в природе (8, 20, 21). Перекрестная защита была первоначально описана для вируса табачной мозаики (TMV) в конце 1920-х годов (22) и с тех пор широко задокументирована для многих других видов вирусов растений (см. Ссылку 21).В сельскохозяйственной практике для борьбы с болезнями применялась перекрестная защита, обеспечиваемая мягкими штаммами вирусов, при этом заметные успехи были достигнуты в борьбе с вирусами, поражающими многолетние культурные растения. К ним относятся вирус опухших побегов какао на какао (23), вирус кольцевой пятнистости папайи на папайе (24) и вирус тристезы цитрусовых (CTV) на цитрусовых (7, 25). Однако, несмотря на обширные исследования, лежащие в основе механизмы, ведущие к перекрестной защите, еще предстоит должным образом изучить и могут включать вмешательство в вирусные взаимодействия, а также механизмы защиты хозяина, сдерживающие инфекцию на клеточном или тканеспецифическом уровне (пересмотрено в ссылках 8 и 21).

    Ранние исследования перекрестной защиты включали последовательную инокуляцию мягкого штамма первичного вируса с последующей контрольной инокуляцией более тяжелым штаммом и последующей оценкой защиты путем обследования симптомов и / или молекулярного обнаружения вторичного захватчика. С появлением клонов инфекционных вирусов сконструированные рекомбинантные вирусы растений, экспрессирующие маркеры визуальной дискриминации, такие как зеленые и красные флуоресцентные белки (GFP и RFP, соответственно), оказались более элегантными инструментами для изучения пространственно-временных взаимодействий вирусов как в клетках, так и в тканях. уровни.Например, когда производные вируса оспы сливы, меченные GFP и RFP, были совмещены с растениями, флуоресцентные маркеры продемонстрировали, что два вируса сосуществовали в одних и тех же листьях растений, но показали, что они занимают в основном неперекрывающиеся кластеры клеток (26). Подобное пространственное разделение или взаимное исключение между вариантами одного и того же вируса наблюдалось для латентного сферического вируса яблони и вируса желтой мозаики фасоли (27, 28), TMV (29, 30), вируса мозаики пшеницы, передаваемого через почву (31), вируса мозаики полос пшеницы. (WSMV) и вирус мозаики Triticum (TriMV) (32) и вирус морщинки репы (TCV) (33).Однако, когда эти вирусы с разными метками были инокулированы последовательно, первичная вирусная инфекция полностью блокировала последующее заражение вторичным захватчиком на уровне всего растения (34–41). Эти наблюдения подтверждают идею о том, что взаимное исключение или SIE происходит на клеточном уровне, и предполагают, что перекрестная защита является проявлением SIE на уровне организма (8).

    Несколько исследований показали, что белки, кодируемые растительным вирусом, могут в достаточной мере, если не исключительно, учитывать перекрестную защиту / SIE.Примеры вирусных детерминант включают белок оболочки (CP) TMV (42), протеиназу вспомогательного компонента (HC-Pro) и CP в вирусе A картофеля (43), протеазу CP и Nia (NIa-Pro) в WSMV и TriMV (32 ), p33 и лидерные протеазы L1 / LII в CTV (38, 44) и p28 в TCV (33). В сельскохозяйственном производстве осознание важности кодируемых вирусами факторов в перекрестной защите / SIE привело к разработке трансгенных противовирусных культур, которые могут защитить растения в поле (45, 46). Хотя подробные молекулярные механизмы, лежащие в основе SIE, не были определены в большинстве исследований, известно, что это явление тесно связано с жизненным циклом вируса.Однако недавнее исследование Zhang et al. (33) предоставило элегантную модель для объяснения TCV p28-опосредованного SIE. В этой модели белки p28 TCV, продуцируемые первичными инфекциями, образуют подвижные многомерные комплексы зависимым от концентрации образом, которые функционируют, чтобы изолировать вновь синтезированные белки p28 из суперинфектора, тем самым предотвращая репликацию последнего в тех же клетках. Последующее исследование, проведенное той же группой, показало, что продукт считывания p28 TCV p88, вирусная РНК-зависимая РНК-полимеризация, также демонстрирует зависимую от концентрации репрессию репликации вируса (47).

    Хотя феномен SIE был изучен для нескольких РНК-вирусов растений с положительной цепью, для растений с РНК-вирусами с отрицательной цепью нет определенной информации. Вирус желтой сети Sonchus (SYNV) представляет собой широко изученный несегментированный вирус с отрицательной цепью РНК, принадлежащий к роду Nucleorhabdovirus , семейству Rhabdoviridae . Геном SYNV кодирует пять структурных белков, обозначаемых нуклеопротеином (N), фосфопротеином (P), матричным белком (M), гликопротеином (G), белком большой РНК-полимеразы (L) и белком движения, sc4, расположенных в заказать NP-sc4-MGL (48–51).В отличие от многих других рабдовирусов, поражающих позвоночных и растения, нуклеорабдовирусы, включая SYNV, подвергаются репликации и морфогенезу вирионов в ядрах инфицированных клеток. При попадании в клетку нуклеокапсиды (NC), высвобождаемые из вирусных частиц, нацелены на ядра, где инициируются первичные раунды транскрипции вирусной мРНК. Вирусные белки, транслируемые с этих мРНК, необходимы для инициации репликации генома для получения антигеномных РНК (агРНК), которые впоследствии используются в качестве матрицы для прямого синтеза геномных РНК (гРНК).И гРНК, и агРНК инкапсидируются во время репликации ядерными белками N, P и L с образованием потомства gNCs и agNCs. Поскольку происходят дополнительные раунды вторичной транскрипции и репликации генома, накопление NCs приводит к образованию больших вироплазм в ядрах (см. Ссылки 49 и 52). На более поздних стадиях репликации накапливающиеся М-белки предположительно функционируют, чтобы скручивать gNC и собираться в вирусные ядра. Благодаря взаимодействиям между карбоксиконцевым хвостом белков M и G, конденсированные ядра NC направляются на внутренние поверхности ядерных мембран, от которых они отталкиваются, чтобы сформировать обволакивающие пулевидные или палочковидные частицы, которые накапливаются в перинуклеарных пространствах (53, 54).

    В этой статье мы использовали сконструированные GFP- и RFP-меченные рекомбинантные варианты SYNV (rSYNV), чтобы показать, что инфекции SYNV вызывают устойчивый SIE у экспериментального хозяина Nicotiana benthamiana. Мы также использовали эктопическую экспрессию белка М и мутантных производных, чтобы показать, что белок М является первичной детерминантой вирусного SIE и выполняет функцию ингибирования транскрипции NC. Эти результаты представляют собой модель, посредством которой белок М, накапливающийся в ядрах, инфицированных первичным вторгающимся производным SYNV, взаимодействует с поступающими вторичными вторгающимися NC SYNV, чтобы исключить суперинфекцию клеток.

    РЕЗУЛЬТАТЫ

    вариантов SYNV, меченных различными флуоресцентными белками, демонстрируют реципрокный SIE. Чтобы исследовать возможный SIE с помощью SYNV, мы использовали клоны rSYNV-GFP и rSYNV-RFP для экспрессии маркеров GFP и RFP (рис. 1A) для визуализации инфекции и движения. . Производные rSYNV отдельно спасали в растениях N. benthamiana после агроинфекции, как описано ранее (51). Равные объемы инфекционных соков из листьев, инфицированных rSYNV-GFP и rSYNV-RFP, смешивали и механически коокулировали на нижние листья здоровых N.растения бентамиана. Через 12 дней после инокуляции (dpi) флуоресценция как GFP, так и RFP была обнаружена с помощью флуоресцентной микроскопии в верхних неинокулированных листьях, что указывает на то, что оба вируса инфицировали растения системно. Однако rSYNV-GFP и rSYNV-RFP на этих листьях занимали отдельные тканевые «островки», которые демонстрировали четкие границы, при этом менее 2% соседних клеток в пограничных областях проявляли флуоресценцию как GFP, так и RFP (Рис. 1B). Чтобы отслеживать взаимодействия вариантов rSYNV в локально инфицированных листьях, мы провели отдельную серию экспериментов по коинфекции, в которых штаммы Agrobacterium tumefaciens, несущие плазмиды, необходимые для выделения rSYNV-GFP и rSYNV-RFP, совместно фильтровались в N.листья бентамианы. Оба варианта rSYNV были выделены в одних и тех же листьях, судя по экспрессии GFP и RFP при 8 dpi, и изолированные одноклеточные очаги начали распространяться на соседние клетки (см. Ссылку 51 и данные не показаны). При 15 dpi, когда происходило обширное перемещение от клетки к клетке, некоторые из расширяющихся фокусов GFP и RFP сходились, и отдельные вирусы на краях занимали смежные клетки, но клетки редко проявляли флуоресценцию обоих репортерных белков (рис. 1C). Эти наблюдения показывают, что варианты SYNV с разными метками обнаруживают взаимное исключение на клеточном уровне.

    FIG 1

    Взаимное исключение вариантов SYNV, помеченных GFP и RFP, у N. benthamiana. (A) Схематические диаграммы, показывающие антигеномы rSYNV, сконструированные для экспрессии GFP (rSYNV-GFP) и RFP (rSYNV-RFP). (B) Изображения z-стека конфокальной микроскопии, показывающие пространственное разделение флуоресцентных фокусов GFP и RFP в верхних системно инфицированных листьях растений N. benthamiana, снятых через 12 дней после инокуляции (dpi) экстрактом листьев, содержащим смеси rSYNV-GFP и rSYNV-RFP. На нижних панелях показаны области, выделенные рамкой, с большим увеличением.Пруток, 100 мкм. (C) Конфокальная микроскопия изображения z-стека смежных фокусов GFP и RFP в ткани листа N. benthamiana с разрешением 15 dpi с агробактериальными смесями, содержащими производные rSYNV-RFP и rSYNV-GFP. Правые панели показывают увеличенные изображения секторов в рамке слева, чтобы выделить границы исключения rSYNV-GFP и rSYNV-RFP в соседних ячейках двух фокусов. Пруток, 50 мкм. (D) Флуоресценция GFP и RFP в верхних листьях растений N. benthamiana после первоначальной инокуляции сока одним вариантом SYNV или имитационной инокуляции с последующей контрольной инокуляцией другим вариантом SYNV, указанной в левой части панелей, через 12 дней.Изображения получали с помощью стереофлуоресцентного микроскопа с каналами GFP или RFP через 20 дней после первичной инокуляции и снова через 20 дней после контрольной инокуляции. 1-й, первичный посевной материал; 2-й, контрольный посевной материал. Пруток, 2 мм. (E) Конфокальная микроскопия листьев N. benthamiana после первоначальной инокуляции сока с помощью rSYNV-RFP с последующей контрольной инокуляцией PVX-GFP через 6 дней. Изображения показывают перекрывающуюся флуоресценцию GFP и RFP в верхних инфицированных листьях, снятых через 6 дней после заражения PVX. Пруток, 100 мкм.

    Затем мы провели вторую серию экспериментов по заражению, в которых нижние листья N. benthamiana были механически инокулированы, чтобы вызвать инфекции rSYNV-RFP, с последующей второй инокуляцией, проведенной через 12 дней в верхние листья, чтобы инициировать инфекции rSYNV-GFP. К 20 дню после второй инокуляции недавно разросшиеся верхние листья проявляли только флуоресценцию RFP (рис. 1D, верхний ряд). Напротив, первичная инфекция rSYNV-GFP полностью блокировала вторичную инфекцию rSYNV-RFP (рис.1Д, третий ряд). В контрольных экспериментах, в которых растения N. benthamiana сначала натирали соком из здоровых листьев, вторичные инокуляции через 12 дней либо rSYNV-GFP, либо rSYNV-RFP приводили к продуктивным инфекциям (рис. 1D, второй и нижний ряды). В другом контрольном эксперименте мы сначала инокулировали инфекционный сок rSYNV-RFP на нижние листья растений N. benthamiana и через 6 дней заражали верхние листья вирусом X (PVX) -GFP картофеля. При разрешении 12 dpi многочисленные клетки верхних листьев были коинфицированы rSYNV-RFP и PVX-GFP, что обозначено желтым цветом, наложенным на изображения GFP и RFP (рис.1E). Эти результаты ясно показывают, что первичное инфицирование вариантом rSYNV защищает растения от последующего вторичного заражения другим вариантом SYNV, но не предотвращает заражение неродственным PVX.

    Сверхэкспрессия белка M ингибирует локальную инфекцию SYNV. Если SYNV SIE опосредуется одним или несколькими вирусными белками, мы предположили, что эктопическая экспрессия белков SYNV будет мешать инфекциям rSYNV. Чтобы проверить эту возможность, гены белков SYNV N, P, sc4, M и G были вставлены в вектор двойной экспрессии, pGD-X / GFP, который также содержит кассету экспрессии GFP, встроенную в ДНК-переносчик (T-ДНК). область, чтобы обеспечить коэкспрессию каждого белка SYNV и GFP после агроинфильтрации.Белок SYNV L не был включен в это исследование, потому что мы не смогли экспрессировать его до обнаруживаемых уровней из-за его большого размера (242 кДа). Чтобы определить, влияет ли коэкспрессия белков SYNV на локализованное распространение SYNV, мы проследили движение фокусов rSYNV-RFP в агроинфильтрованных листьях с помощью флуоресцентной микроскопии. Как наблюдалось ранее (51), одноклеточные фокусы RFP появлялись при 8 dpi, а затем распространялись на соседние клетки на 12 dpi (рис. 2A). Считалось, что в фокусах, экспрессирующих флуоресценцию GFP при 12 dpi, одновременно экспрессируются вирусные белки и GFP, что было дополнительно подтверждено вестерн-блоттингом тканевых экстрактов с использованием антител против вирусных белков и GFP (рис.2Б).

    FIG 2

    Ингибирование локализованных инфекций rSYNV-RFP путем эктопической экспрессии белков SYNV. (A) Наблюдение с помощью флуоресцентной микроскопии листьев N. benthamiana после агроинфильтрации для инициации локальных инфекций rSYNV и для экспрессии каждого из белков SYNV N, P, sc4, M и G или пустого векторного контроля. Обратите внимание, что каждый из вирусных белков был экспрессирован из двойной бинарной плазмиды, которая также содержит кассету экспрессии GFP для визуализации инфильтрированных участков листа. Инфильтрованные листья наблюдали под стереофлуоресцентным микроскопом при 8 dpi и снова при 12 dpi для оценки местных инфекций в течение 4-дневного периода движения.Две верхние панели показывают экспрессию RFP, а нижняя панель показывает объединенные изображения экспрессии RFP и GFP в клетках листа, окружающих фокусы RFP rSYNV. Пруток, 200 мкм. (B) Вестерн-блоттинг для определения уровней экспрессии GFP и присутствия вирусных белков с использованием поликлональных антител против вирионов SYNV (α: SYNV), sc4 (α: sc4) и GFP (α: GFP). Окрашенную большую субъединицу RuBisCO использовали в качестве контроля загрузки. (C) Расчет среднего количества клеток, экспрессирующих RFP, на очаг инфекции rSYNV-RFP при 12 dpi.Столбцы представляют собой стандартные отклонения. Звездочки обозначают статистическую значимость ингибирования белка М по критерию Стьюдента t ( P <0,001; n = 24). (D) Наблюдение за локальным движением PVX-GFP, кофильтрованного с SYNV M или пустым вектором при 60 hpi и 6 dpi, с помощью флуоресцентного микроскопа. Пруток, 200 мкм. (E) Вестерн-блоттинг уровней экспрессии GFP в тканях листа, инфильтрованных PVX-GFP с белком SYNV M или без него, при 6 dpi. Окрашенную большую субъединицу RuBisCO использовали в качестве контроля загрузки.(F) Расчет средних площадей очагов инфекции PVX-GFP при 6 dpi. NS: статистически недостоверно ( P > 0,05; n = 20) по результатам анализа с помощью теста Стьюдента t .

    Коэкспрессия белка M привела к значительному уменьшению локализованного распространения rSYNV-RFP, тогда как коэкспрессия белков N, P, sc4 или G оказала незначительное влияние на распространение rSYNV-GFP (рис. 2A). Статистический анализ увеличения количества клеток, экспрессирующих RFP, между 8 и 12 днями показал, что эктопическая экспрессия белка M ингибировала транспорт SYNV от клетки к клетке примерно на 2.В 0–2,5 раза по сравнению с движением в ткани, содержащей эктопически экспрессируемый белок SYNV N, P, sc4 или G или отрицательный контроль (рис. 2С). Чтобы исключить возможность того, что эктопически экспрессируемый белок M ингибирует движение SYNV, неспецифически воздействуя на клетки-хозяева, например, ингибируя синтез белка, мы протестировали влияние белка M на локальное перемещение PVX-GFP, вируса, который не отображает SIE с SYNV. (Рис. 1E). В аналогичных условиях временной экспрессии белок SYNV M оказывал незначительное влияние на движение PVX-GFP (рис.2D). Этот вывод был дополнительно подтвержден анализом белкового гель-блоттинга уровней GFP (фиг. 2E) и количественным анализом средней площади очагов инфекции PVX-GFP (фиг. 2F) при 6 dpi. Таким образом, эти результаты предполагают, что эктопическая экспрессия белка М специфически ингибирует локальные инфекции SYNV.

    делеционные мутанты SYNV M демонстрируют скомпрометированный SIE. Для дальнейшего изучения участия белка M в SYNV SIE мы проверили, влияет ли мутант rSYNV-RFP с делецией в гене M (rSYNV-RFP-ΔM) на SIE, анализируя способность мутантного вируса для предотвращения суперинфекции rSYNV-GFP.В качестве контроля в этот эксперимент был включен мутант с делецией SYNV G (rSYNV-RFP-ΔG), поскольку белки G и M играют совместную роль в почковании и созревании вирионов (54). Следовательно, листья N. benthamiana были инфильтрированы смесями агробактерий, несущих плазмиды, необходимые для одновременного восстановления rSYNV-GFP и либо rSYNV-RFP, rSYNV-RFP-ΔM, либо rSYNV-RFP-ΔG. Клетки, экспрессирующие GFP и / или RFP на границах сливающихся фокусов, визуализировали с помощью флуоресцентной микроскопии при 15 dpi для оценки взаимодействий SIE между производными SYNV.Как показано на фиг. 3, красные и зеленые флуоресцентные сигналы в листьях, коинфицированных rSYNV-GFP и rSYNV-RFP, всегда были пространственно разделены в соседних фокусах эпидермальных клеток листа. Подобные отдельные паттерны распределения флуоресценции наблюдались в соседних очагах листьев, коинфицированных rSYNV-GFP и rSYNV-RFP-ΔG. Напротив, значительная часть клеток, расположенных на границах фокусов rSYNV-GFP и rSYNV-RFP-ΔM, проявляла флуоресценцию как GFP, так и RFP (рис.3, белые стрелки), что позволяет предположить, что SIE был менее распространен в rSYNV-RFP. -ΔM инфекции.

    Рис. 3.

    Идентификация белка SYNV M как детерминанты исключения вирусной суперинфекции (SIE). Листья N. benthamiana были коинфицированы посредством агроинокуляции парой rSYNV-GFP и rSYNV-RFP, rSYNV-GFP и rSYNV-RFP-ΔM, rSYNV-GFP и rSYNV-RFP-ΔG или rSYNV-GFP и rSYNV11. UAA . Смежные фокусы GFP и RFP в инокулированных тканях листа с разрешением 15 dpi визуализировали с помощью конфокальной микроскопии, чтобы показать исключение флуоресценции между фокусами. Белые стрелки указывают граничные ячейки, экспрессирующие как GFP, так и RFP.Пруток, 100 мкм.

    Для получения дополнительной аналитической информации количество клеток, коинфицированных rSYNV-GFP / rSYNV-RFP, и клеток, инфицированных rSYNV-GFP / rSYNV-RFP-ΔM или rSYNV-GFP / rSYNV-RFP-ΔG, сравнивали в трех независимых экспериментах. . Таблица 1 показывает, что средний процент граничных клеток, демонстрирующих флуоресценцию как GFP, так и RFP, увеличился до ~ 25% для инфекций rSYNV-GFP / rSYNV-RFP-ΔM, в отличие от ~ 1,5% для инфекций rSYNV-GFP / rSYNV-RFP и 1,9% для rSYNV-GFP / rSYNV-RFP-ΔG.Эти данные показывают, что делеция гена белка М приводит к значительному снижению активности SYNV SIE.

    ТАБЛИЦА 1

    Процент граничных клеток, коинфицированных производными rSYNV-GFP и rSYNV-RFP в инокулированных листьях Nicotiana benthamiana

    Чтобы определить, требуется ли последовательность РНК или белок, кодируемый геном M, в SIE, мы создали rSYNV-RFP -M UAA , в котором кодон инициации AUG цистрона M был изменен на стоп-кодон UAA для исключения трансляции белка.При коинфекции rSYNV-GFP в листьях N. benthamiana мутант rSYNV-RFP-M UAA также проявлял скомпрометированную способность к SIE, поскольку флуоресценция RFP и GFP была очевидна в одних и тех же клетках (рис. 3, нижний ряд). Количественный анализ показал, что около 21% пограничных клеток проявляли флуоресценцию как GFP, так и RFP в тканях, коинфицированных rSYNV-GFP / rSYNV-RFP-M UAA (Таблица 1). Взятые вместе, эти данные указывают на то, что белок SYNV M, а не последовательность РНК, отвечает за активность SIE.

    Белок SYNV M подавляет транскрипцию вирусных мРНК. Исследования рабдовирусов животных показали, что белок M этих вирусов подавляет транскрипцию вирусов как in vitro , так и in vivo (55–58). Чтобы оценить, может ли репрессия транскрипции учитывать M-опосредованный SIE при инфекциях SYNV, мы затем проверили, подавляет ли белок SYNV M транскрипцию геномной РНК SYNV, используя систему минирепликона (MR), которая, как было показано ранее, воспроизводит синтез аутентичной вирусной РНК (59). .В системе SYNV MR вирусные РНК-подобные транскрипты MR, кодирующие репортерные гены GFP и RFP, заменяют цистроны N и P (рис. 4A). Листья N. benthamiana подвергали агроинфильтрации смесями бактерий, несущих плазмиды, для экспрессии геномно-смысловых транскриптов MR [негативный MR, (-) MR] и ядерных белков N, P и L, а также трех вирусных супрессоров подавления РНК ( VSR), как описано ранее (59). При доставке конструкций, экспрессирующих вирусные компоненты, одноклеточные очаги, экспрессирующие как репортерные белки GFP, так и RFP, наблюдались во всех инфильтрированных областях листьев с разрешением 8 dpi (рис.4Б). Когда SYNV MR коэкспрессировался в комбинации с геном белка М, количество очагов, демонстрирующих оба репортерных белка, уменьшалось в 50 раз по сравнению с уровнем контроля с пустым вектором (фиг. 4B и C). В качестве дополнительных контролей совместная экспрессия SYNV MR либо с мутантом M UAA , либо с белком sc4 оказала незначительное влияние на экспрессию репортерного гена из SYNV MR. Анализ протеинового гель-блоттинга показал, что ядерные белки N и P, которые необходимы для функций MR, были экспрессированы до аналогичных уровней в инфильтрированных тканях листа с эктопической экспрессией M-белка или без нее.Также были подтверждены pGD-опосредованная экспрессия белков M и sc4 и отсутствие трансляции белка M мутантом M UAA (фиг. 4D). Белковые блоты также подтвердили, что уровни белков GFP и RFP в тканях листа, коэкспрессирующих белок М, были значительно снижены по сравнению с коэкспрессией sc4, M UAA или пустого вектора (фиг. 4D). Поскольку gNC, собранные из (-) MR транскриптов и основных белков в инфильтрированных тканях листа, могут участвовать в синтезе вирусной РНК, образцы тотальной РНК, выделенные из инфильтрированных тканей, были гибридизированы с зондом GFP для обнаружения агРНК и мРНК GFP (рис.4E). Гель-блот РНК выявил полосу, размер которой аналогичен маркеру размера агРНК MR из 1791 нуклеотидов (нт) в тканях листа, экспрессирующих белок N, P и L, а также транскрипты (-) MR. Кроме того, также была обнаружена другая полоса, мигрирующая немного медленнее, чем 720-нуклеотидная маркерная РНК GFP. Эта полоса соответствует размеру мРНК MR GFP, которая, как ожидается, будет содержать 5'-нетранслируемую область и 3'-поли (A) последовательности. Экспрессия белка M, но не белка M UAA или sc4, резко снизила агРНК MR и мРНК GPF до уровней, аналогичных уровням в образце отрицательного контроля, в котором три основных белка не экспрессировались (-NPL) .В качестве дополнительного контроля мы показали, что белок SYNV M, по-видимому, не влиял на экспрессию репортерного гена GFP из неродственного репликона PVX-GFPΔp25, в котором ген белка движения p25 был заменен геном GFP (рис. 4F и G), что позволяет предположить что ингибирующий эффект белка М вирусспецифичен. Вместе эти результаты предполагают, что эктопическая экспрессия белка М значительно подавляет синтез вирусной РНК из матриц gNC.

    Рис. 4

    Подавление вирусной транскрипции белком М в системе минирепликона SYNV (MR).(A) Схематические диаграммы генома SYNV и кассеты MR отрицательного смысла. (-) MR содержит 3'-лидерные (le) и 5'-концевые (tr) последовательности, фланкирующие репортерные гены GFP и RFP, замещенные генами SYNV N и P. (B) Визуализация репортерных белков GFP и RFP в листьях N. benthamiana, подвергнутых агроинфильтрации с культурами Agrobacterium , несущими плазмиды для экспрессии SYNV MR и ядерных белков N, P и L. Дополнительные бактериальные культуры, содержащие пустой вектор (Vec), плазмиды pGD-M, pGD-M , UAA и pGD-sc4, как указано в верхней части каждой панели, также были включены в смеси для проверки их влияния на экспрессию репортера. .Инфильтрованные листья фотографировали с разрешением 8 dpi с помощью флуоресцентного микроскопа. Пруток, 200 мкм. (C) Среднее количество клеток на поле, экспрессирующих GFP и RFP при 8 dpi при каждой обработке SYNV MR. Столбцы представляют собой стандартные отклонения. Звездочкой обозначена значимость теста Стьюдента t ингибирования транскрипции белком М ( P <0,001; NS, не значимо; n = 12). (D) Вестерн-блоттинг, подтверждающий экспрессию GFP и RFP в каждой группе. Экспрессию ядерных белков N и P или белка M или sc4 детектировали с помощью поликлональных антител против вириона SYNV или против белка sc4, соответственно.Большая субъединица RuBisCO, окрашенная кумасси синим, обеспечивает контроль загрузки. (E) Нозерн-блот-гибридизация, демонстрирующая ингибирующие эффекты белка М на синтез SYNV MR РНК. Тотальную РНК, экстрагированную из тканей листа N. benthamiana, показанную на панели B, подвергали блоттингу с помощью зонда GFP с отрицательным смыслом для обнаружения агРНК MR и мРНК GFP. РНК из тканей листа, инфильтрированных (-) MR в отсутствие белков N, P и L, использовали в качестве отрицательного контроля. In vitro транскриптов T7, соответствующих по размеру GFP и MR agRNA (agMR), использовали в качестве маркеров размера.25S рРНК окрашивали бромидом этидия, чтобы показать равную нагрузку РНК. (F и G) Отсутствие ингибирующих эффектов белка SYNV M на экспрессию репортерного гена GFP из репликона PVX. Листья N. benthamiana подвергали агроинфильтрации смесями штаммов Agrobacterium , несущих плазмиду PVX-GFPΔp25 вместе с pGD-M или пустым вектором. Одноклеточные фокусы GFP визуализировали с помощью флуоресцентного микроскопа с разрешением 3 dpi, рассчитывали среднее количество клеток на поле и анализировали статистическую значимость с помощью теста Стьюдента t .NS, статистически недостоверно ( P > 0,05; n = 12).

    Мутанты SYNV M, дефектные по ядерной локализации, не могут ингибировать вирусную транскрипцию. Репликация SYNV и созревание вириона происходят в инфицированных ядрах, в которых также локализован M-белок (53, 54). Последовательность белка М ( 226 GKVVRKRKSRK 236 ) была постулирована Jackson et al. (49), чтобы служить сигналом ядерной локализации (NLS). Чтобы расширить эту гипотезу, мы использовали компьютерный алгоритм PSORT (https: // wolfpsort.hgc.jp/), чтобы идентифицировать четыре последовательные основные аминокислоты, 230 RKRK 233 , в качестве ключевых остатков NLS. Чтобы проверить NLS-функцию этих остатков, мы мутировали остатки 230 RKRK 233 в 230 RARA 233 и 230 AAAA 233 , чтобы получить мутанты M RARA и M AAAA . При слиянии с голубым флуоресцентным белком (CFP) и временной экспрессии в эпидермальных клетках N. benthamiana белок М дикого типа локализуется исключительно в ядрах, тогда как мутанты M RARA и M AAAA проявляют как цитоплазматическую, так и ядерную локализацию. (Рисунок.5А). Эти данные демонстрируют, что мотив RKRK играет важную роль в ядерном импорте М-белка. Затем мы использовали двухмолекулярную комплементацию флуоресценции (BiFC), чтобы определить, взаимодействуют ли белки М дикого типа и мутировавшие М белки с белком N и где эти взаимодействия расположены. Как и ожидалось, N-M взаимодействия были обнаружены только в ядрах, где они были связаны с крупными субядерными включениями. Напротив, сигналы взаимодействия N-M RARA и N-M AAAA присутствовали как в цитоплазме, так и в ядрах, а фокусы ядерного желтого флуоресцентного белка (YFP) были более многочисленными и намного меньше, чем фокусы взаимодействия N-M (рис.5B), предполагая, что они не могли слиться с образованием крупных фокусов. Более того, поскольку белок N также имеет сигналы ядерной локализации (60), появление цитоплазматических фокусов YFP предполагает, что взаимодействия между мутантами белка N и M происходят в основном в цитоплазме и что цитоплазматические комплексы N-M не могут быть импортированы в ядра. Эти данные указывают на то, что мутанты M NLS лишены ядерной локализации и взаимодействий с N-белком в ядрах.

    FIG 5

    Субклеточная локализация, взаимодействия с белком N и способность подавлять транскрипцию MR мутантами SYNV M с ядерной локализацией.(A) Конфокальные микрофотографии, показывающие репортерный белок RFP-гистон 2B (RFP-h3B) трансгенных эпидермальных клеток листьев N. benthamiana, экспрессирующих слияния CFP-M, CFP-M , RARA и CFP-M AAAA . Пруток, 20 мкм. (B) Анализы бимолекулярной флуоресцентной комплементации (BiFC) для определения взаимодействий белка N с М дикого типа или мутантным белком M RARA или M AAAA . Эпидермальные клетки листьев трансгенных растений RFP-h3B N. benthamiana подвергали агроинфильтрации для экспрессии N-концевого слияния YFP с N (YN-N) и С-концевого слияния YFP с производными M (YC-M).Показаны конфокальные микрофотографии YFP (BiFC), RFP-h3B (ядра) и объединенного канала. Пруток, 20 мкм. (C) Визуализация флуоресцентной микроскопии экспрессии репортерного гена SYNV (-) MR при 8 dpi в листьях N. benthamiana, коинфильтрованных для экспрессии либо пустого векторного контроля (Vec), либо белка M, M RARA или M AAAA . Пруток, 200 мкм. (D) Среднее количество клеток на поле, экспрессирующее GFP и RFP с разрешением 8 dpi при каждой обработке SYNV MR, показанной на панели C. Столбцы представляют собой стандартные отклонения.***, P <0,001; NS, не значимо (по критерию Стьюдента t ; n = 20). (E) Вестерн-блоттинг, показывающий экспрессию белка M, M , RARA или M AAAA с белками N и P в каждой группе. Большая субъединица RuBisCO, окрашенная кумасси синим, обеспечивает контроль загрузки.

    Затем мы оценили способность мутантов M NLS подавлять транскрипцию мРНК репортера MR. Мутанты M NLS временно экспрессировались в листьях N. benthamiana вместе с компонентами, необходимыми для (-) MR активности, а уровни экспрессии GFP и RFP исследовали при 8 dpi с помощью флуоресцентной микроскопии.Несмотря на сохранение частичной ядерной локализации и взаимодействия с белком N, ни белок M RARA , ни белок M AAAA не оказали заметного ингибирующего действия на экспрессию MR-репортера, о чем свидетельствует визуализация флуоресценции (рис. 5C) и количественный анализ количество флуоресцентных фокусов (рис. 5D). В качестве положительного контроля белок М дикого типа заметно снижал экспрессию репортера (фиг. 5C и D). Вестерн-блот-анализ образцов белка, экстрагированных из инфильтрированных тканей листа, показал, что два мутанта M, особенно мутант M AAAA , накапливались до более высоких уровней, чем белок M дикого типа (рис.5D). Следовательно, отсутствие ингибирующих функций у мутантов M NLS не было следствием сниженной экспрессии белка, но, вероятно, было связано с нарушением взаимодействий белка M с белком N в ядрах, которые влияют на свертывание NC.

    Производные

    rSYNV, несущие мутации M NLS, дефектны в отношении активности SIE. Продемонстрировав, что мутанты M NLS неспособны подавлять вирусную транскрипцию, мы затем ввели эти мутации в геном rSYNV-RFP и проверили способность мутантных вирусов ингибировать суперинфекция rSYNV-GFP.В этих тестах листья N. benthamiana подвергали агроинфильтрации, чтобы инициировать коинфекцию rSYNV-GFP и либо rSYNV-RFP, rSYNV-RFP-M RARA , либо rSYNV-RFP M AAAA . При всех комбинациях дискретные одноклеточные фокусы GFP и RFP наблюдались в инфильтрированных тканях листа при 8 dpi, и фокусы распространялись на окружающие клетки на 15 dpi. Как и ожидалось, клетки, коэкспрессирующие GFP и RFP, не наблюдались на краях смежных очагов родительской коинфекции rSYNV-GFP / rSYNV-RFP, что указывает на активность SIE.Напротив, суперинфекция была очевидна в значительном количестве соседних клеток сливающихся фокусов комбинаций rSYNV-GFP / rSYNV-RFP-M RARA и rSYNV-GFP / rSYNV-RFP-M AAAA , о чем свидетельствует желтая флуоресценция. в этих ячейках (белые стрелки на рис. 6). В трех независимых экспериментах ~ 14% и ~ 17% пограничных клеток соседних очагов были коинфицированы комбинациями rSYNV-GFP / rSYNV-RFP-M RARA и rSYNV-GFP / rSYNV-RFP-M AAAA , соответственно.Количество суперинфицированных клеток в этих комбинациях было лишь умеренно ниже, чем 25%, обнаруженных при инфекциях rSYNV-GFP / rSYNV-RFP-ΔM, но было намного больше, чем частота коинфекции 1,5% при инфекциях rSYNV-GFP / rSYNV-RFP (Таблица 1). Из этих данных мы заключаем, что способность белка М подавлять вирусную транскрипцию необходима для исключения суперинфекции родственными производными SYNV.

    Рис. 6

    SIE-активности мутантов ядерной локализации rSYNV и rSYNV M. Листья N. benthamiana были коинфицированы посредством агроинокуляции вирусными парами rSYNV-GFP и rSYNV-RFP, rSYNV-GFP и rSYNV-RFP-M RARA или rSYNV-GFP и rSYNV-RFP-M AAAA .Смежные фокусы GFP и RFP в инокулированных тканях листа с разрешением 15 dpi визуализировали с помощью конфокальной микроскопии, чтобы показать исключение флуоресценции между фокусами. Белые стрелки указывают граничные ячейки, экспрессирующие как GFP, так и RFP. Пруток, 100 мкм.

    ОБСУЖДЕНИЕ

    Хотя феномен SIE был широко изучен на многих вирусах с положительной цепью РНК с использованием различных методов и, как известно, тесно связан с жизненным циклом вируса, лежащие в его основе механизмы только начинают проявляться (см. Ссылки 61 и 62).Однако наши знания о SIE, вызванном вирусами РНК с отрицательной цепью растений, особенно ограничены, и это частично связано с техническими трудностями, связанными с генной инженерией этой группы вирусов (52). В текущем исследовании мы использовали различные меченные флуорофором варианты rSYNV для изучения их взаимодействия в модельном хозяине N. benthamiana. Наши эксперименты с коинфекцией и последовательным заражением предоставляют убедительные доказательства, демонстрирующие, что SIE / перекрестная защита происходит во время инфекций SYNV как на клеточном, так и на уровне организма.Насколько нам известно, это исследование представляет собой первую демонстрацию SIE для вируса растений с РНК с отрицательной цепью.

    SIE был задокументирован для модели рабдовируса животных, вируса везикулярного стоматита (VSV), 3 десятилетия назад, и результаты показали, что трансмембранный G-белок VSV необходим для SIE и влияет на процессы начального уровня (63). Дальнейшие исследования показали, что G-белок, экспрессируемый ранее существовавшими инфекциями VSV, блокирует рецепторно-опосредованный эндоцитоз вторичных инвазий штаммов VSV (64).Однако, в отличие от рабдовирусов человека / животных, вирусы растений, как известно, не проникают в клетки-хозяева через специфический процесс, опосредованный рецепторами мембранной поверхности, и этапы их проникновения, по-видимому, облегчаются кормлением насекомых или физическим повреждением клеточной стенки. Кроме того, белок SYNV G, по-видимому, незаменим для перемещения от клетки к клетке и проникновения в дистальные клетки (51). Следовательно, предлагаемый механизм VSV маловероятен для SIE, запускаемого SYNV, который, вероятно, происходит на постентарных уровнях.

    Чтобы сузить возможные вирусные детерминанты SIE, каждый из белков SYNV эктопически экспрессировался в SYNV-инфицированных листьях, и эти эксперименты привели к идентификации белка M как специфического ингибитора локальных инфекций SYNV. Подход с потерей функции, использующий анализ мутантов rSYNV-RFP-ΔM и rSYNV-RFP-M UAA , предоставил прямые доказательства участия белка M, а не мРНК M в выявлении SIE. Используя аналогичный подход, ранее было обнаружено, что p33, кодируемый CTV, является вирусной детерминантой SIE, поскольку мутант CTV с делецией в гене p33 (CTVΔp33) не смог защитить инфицированные растения от того же штамма на уровне всего растения ( 38, 39).В отличие от белка p33 CTV, который незаменим при системной инфекции и перемещении (65), мутант rSYNV-RFP-ΔM дефектен при системных инфекциях, но способен к локализованным инфекциям (51). Таким образом, мы проанализировали SIE между rSYNV-RFP-ΔM и rSYNV-GFP в локально инфицированных клетках, и результаты показали, что rSYNV-RFP-ΔM не содержал SIE на клеточном уровне. Параллельные эксперименты с мутантом rSYNV-RFP-ΔG не смогли продемонстрировать роль белка G в SIE; следовательно, механизм SYNV SIE отличается от этапа проникновения вируса, предложенного для VSV SIE.

    В частицах рабдовируса матричный белок образует мост между спиральным ядром нуклеокапсида и трансмембранным G-белком (66–69). Исследования с VSV и другими рабдовирусами животных показали, что на поздних стадиях репликации белок M скручивает gNC в компактную структуру, аналогичную ядру в форме пули, наблюдаемому в вирионе рабдовируса (70, 71). Конденсированные gNC, по-видимому, неспособны функционировать в транскрипции мРНК, потому что активность транскриптазы подавляется в условиях in vitro и in vivo (55–58).Сходные функции, вероятно, разделяют белки М, кодируемые рабдовирусами растений, учитывая их консервативную структуру генома и стратегию репликации (49). Действительно, используя (-) MR систему, которая может собираться с коэкспрессируемыми коровыми белками в gNC in vivo , мы показали, что эктопическая экспрессия белка SYNV M значительно ингибирует экспрессию репортерного гена.

    Мы обнаружили, что мутанты SYNV M NLS с ослабленной ядерной локализацией были неспособны подавлять экспрессию репортерного гена MR.Эти данные предполагают, что конденсация NC и ингибирование транскрипции требуют высоких уровней белка М в ядрах, в которых происходит репликация SYNV. Следовательно, rSYNV-RFP-M , RARA и rSYNV-RFP-M AAAA были дефектными в проявлении SIE, скорее всего, из-за того, что ядра клеток, инфицированные этими мутантами вируса, испытывают недостаток в достаточном количестве белка М, чтобы инициировать или поддерживать скручивание NC бросая вызов второстепенным захватчикам SYNV. Эта гипотеза подтверждается исследованием кинетики сборки / разборки in vitro VSV, которое показало, что высокие концентрации белка М способствуют образованию комплекса NC-M с константой диссоциации порядка 1 мкМ (72).Более раннее исследование динамики инфекции VSV показало, что сборка вирионов начинается примерно через 2 часа после инфицирования и достигает пика через примерно 4-6 часов после заражения (73). В течение этого периода времени концентрация внутриклеточного М-белка повышается примерно с 1 до 30 мкМ (73), уровня, достаточного для управления сборкой комплексов NC-M (72). После образования начального комплекса NC-M сборка ядра вириона дополнительно облегчается движущими силами, обеспечиваемыми совместными самовзаимодействиями М. Белок VSV M мультимеризуется при физиологических концентрациях NaCl (74) и образует большие агрегаты, которым помогают сайты нуклеации вблизи N-концевой области (75).Предыдущие тесты BiFC также показали, что белок SYNV M подвергается самоассоциациям, которые проявляются в виде крупных точечных субядерных очагов (76).

    Объединив знания о циклах репликации рабдовирусов (49, 77) с данными, представленными в этом исследовании, мы предлагаем регуляторный механизм, связанный с фазой инфекции, для объяснения SYNV SIE (рис. 7). На ранних и промежуточных стадиях репликации после первичной инфекции белок М накапливается до относительно низких уровней из-за прогрессирующих сигналов ослабления транскрипции, присутствующих в каждой из последовательностей соединения генов (49, 77).Это приводит к более низким уровням транскрипции мРНК М по сравнению с уровнями 3'-генов N, P и sc4. На этих стадиях белок M может ассоциироваться с вновь образованными gNC, но, вероятно, не на достаточном уровне для полной конденсации NC, а инфицированные клетки допускают дополнительные циклы репликации и транскрипции и накопления NC. Однако на более поздних стадиях репликации SYNV, когда белок М накапливается в ядрах до уровней, достаточных для запуска конденсации NC, происходит переход от репликации к сборке вириона.На этой стадии ядра, инфицированные первичным заражающим штаммом SYNV, будут активно участвовать в свертывании нуклеокапсида, и входящие gNC, высвобождаемые из вторичного вторгающегося SYNV, не будут раскручиваться в достаточной степени, чтобы инициировать новые инфекции. Следовательно, клетки, поддерживающие более поздние стадии инфицирования первичного штамма заражающего вируса, больше не будут допускать продуктивную репликацию вторичным вторгающимся вирусом (рис. 7).

    РИС. 7.

    Рабочая модель для иллюстрации SIE, опосредованной белком SYNV M. После проникновения в клетки геномные нуклеокапсиды (gNC), освобожденные из вирионов первичного захватчика (показаны синим цветом), импортируются в ядра и инициируют первичную транскрипцию вирусных мРНК (этап 1).Транскрипты первичных мРНК экспортируются в цитоплазму для синтеза вирусных белков (этап 2). Вновь синтезированные ядерные белки N, P и L впоследствии импортируются в ядра, где они образуют вироплазмы и участвуют во вторичных раундах транскрипции мРНК и репликации антигеномной и геномной РНК потомства и инкапсидации с образованием NC потомства (этап 3). Белок М также импортируется в ядра, но накапливается до относительно низких уровней на ранних и промежуточных стадиях репликации из-за полярной транскрипции вирусной мРНК.Однако по мере прохождения циклических волн транскрипции и репликации (повторяющиеся шаги с 1 по 3) накапливающийся белок М начинает инициировать сворачивание gNC и тушение транскрипции вирусной мРНК. Впоследствии свернутые в спираль ядра gNC взаимодействуют с карбоксиконцевой областью трансмембранного G белка и зачатком через внутреннюю ядерную оболочку с образованием зрелых вирионов (стадия 4). Поступающие gNC, высвобождаемые вторичными захватчиками (показаны пурпурным цветом), проникающие в эти клетки, свертываются или предотвращаются от раскручивания из-за большого количества М-белков, которые накапливаются в ядрах на более поздних стадиях первичной инфекции (стадия 5).Этот процесс секвестрации NC отменяет транскрипцию мРНК вторичными захватчиками и приводит к SIE.

    Динамика инфицирования клеток SYNV детально не охарактеризована, но если предположить, что они аналогичны динамикам VSV (73), временное окно от фазы разрешения суперинфекции до фазы исключения суперинфекции может составлять несколько часов. Учитывая несинхронный характер вирусных инфекций, два варианта SYNV, попавшие в одни и те же клетки, вряд ли вызовут инфекцию одновременно или даже в течение очень короткого интервала.Следовательно, клетки с установленной инфекцией более ранним вариантом SYNV не будут допускать повторного заражения более поздними вариантами SYNV, и коинфекции будут проявляться пространственным разделением двух вариантов в соседних очагах. Однако, если два варианта действительно инициируют инфекции в одних и тех же клетках в пределах разрешающего окна, возможны суперинфекции, о чем свидетельствует небольшой процент (~ 1,5%) клеток, экспрессирующих флуоресценцию как GFP, так и RFP после коокуляций rSYNV-GFP и rSYNV. -RFP (Таблица 1).

    Наша модель напоминает модель TCV p28 в том, что обе модели постулируют, что фазовый переход инфекции, зависящий от концентрации вирусного белка, объясняет суперинфекцию по сравнению с SIE. В модели TCV накопление белка репликации p28, продуцируемого многочисленными геномами потомства, трансформирует цикл инфекции из активного состояния репликации в состояние репрессии репликации (фаза пострепликации). Этот переход инициируется зависимой от концентрации полимеризацией p28, приводящей к образованию крупных агрегатов, которые секвестрируют вновь синтезированные мономеры p28, в том числе транслируемые из вторичных инвазивных вирусных геномов (33).Другим хорошо изученным примером SIE у вирусов растений является CP-опосредованная перекрестная защита, описанная для TMV и некоторых других вирусов с положительной цепью РНК растений (32, 42, 43, 78). Было высказано предположение, что SIE, опосредованный CP TMV, включает несколько способов вмешательства, включая предотвращение расплетения и / или блокирование сборки репликазы вторичных инвазивных вирусных геномов (42, 79, 80). С TMV эта активность требует способности CP собираться в большие агрегаты посредством самоассоциации и связываться с вирусной РНК (81–83).И модель SIE TMV, и наша модель постулируют, что обильный фактор сборки вируса (TMV CP и SYNV M), продуцируемый на поздних стадиях первичных инфекций, отвечает за покрытие / секвестр вирусных инфекционных единиц (т. Е. GRNA TMV и gNC SYNV). вторичных захватчиков для предотвращения суперинфекции. Таким образом, похоже, что SIE различных вирусов может включать в себя разные функции конкретных вирусных белков, но все они проявляются как вмешательство в ранние стадии заражения вторичным инвазивным вирусом более продвинутыми стадиями, участвующими в синтезе первичного инвазивного вируса.Продуктивные вирусные инфекции требуют координации цепочки временных и последовательных событий, включая снятие оболочки, трансляцию, репликацию, перемещение от клетки к клетке и сборку вирионов. (Обратите внимание, что в случае вирусов с РНК с отрицательной цепью этап транскрипции предшествует трансляции.) Переход от одной фазы к другой часто включает конкуренцию за вирусные белки или РНК и может даже привести к прекращению ранних событий (84). Следовательно, вторичные захватчики, проникающие в ранее инфицированные клетки, сталкиваются с проблемой координации с существующими стадиями инфекции для установления суперинфекции.В этом смысле SIE можно рассматривать как побочный эффект, вызванный фазовыми переходами инфекции.

    МАТЕРИАЛЫ И МЕТОДЫ

    Плазмиды и рекомбинантные вирусы. Плазмиды, используемые для выделения rSYNV-GFP, rSYNV-RFP, rSYNV-RFPΔM и rSYNV-RFPΔG, были описаны в предыдущих исследованиях (51, 54). Плазмида PVX-GFP была сконструирована, как описано van Wezel et al. (85). Чтобы сконструировать варианты rSYNV-RFP с мутациями в гене M, кодон инициации AUG кодирующей области M был изменен на стоп-кодон UAA посредством сайт-направленного мутагенеза с образованием мутанта M UAA .Аналогичным образом, ядерные импортируемые остатки M 230 RKRK 233 были мутированы в RARA или AAAA для получения мутантов M RARA и M AAAA . Чтобы ввести эти мутации M в геном rSYNV-RFP, фрагмент F1, содержащий часть гена P, был амплифицирован из плазмиды pSYNV-RFP с использованием пары праймеров SYNV / P / NheI / F (5'-AAGAGAAGGGGCTAGCATGTC-3 ' ) и SYNV / M UAA / R (5′-GTATATACCTGCTTATCTGAAATACAATAGAGATAACCTTG-3 ′), а фрагмент F2, содержащий часть гена M, был амплифицирован с использованием пары праймеров SYNV / M UAA / F (5′- TAAGCAGGTATATACGCAGTTTCAA-3 ') и SYNV / M / PmlI / R (5'-CATCACGACTGACACGTGACCT-3').В два фрагмента вливали pSYNV-RFP, дважды расщепленный NheI и PmlI, с получением pSYNV-RFP-M UAA . Аналогичная стратегия была использована для создания мутантов pSYNV-RFP-M RARA и M AAAA с праймерами SYNV / sc4 / BstZ17I / F (5'-GCAAGTACTTTGGTATACAAGAAAGG-3 ') и SYNV / G / BstZ17I / R ( 5'-TCTTGAATACTGGTATACTTATTCCCACA-3 ').

    Геномно-смысловая плазмида SYNV MR [pSYNV-MR GFP-RFP (-)] была получена из антигеномно-смыслового минирепликона [MR GFP-RFP (+)], описанного Ganesan et al.(59). Вкратце, последовательность MR амплифицировали с помощью ПЦР с праймерами MR / трейлер / F (5'-CCGGTATCCCGGGTCAGAGACAAAAGCTCAGAACAATCC-3 ') и MR / лидер / R (5'-ATGCCATGCCGACCCAGAGACAGAAACTCAGAAAATACAATC-3') последовательности рибозима «головка молотка» и рибозима вируса гепатита D амплифицировали с праймерами MR / backbone / F (5'-GGGTCGGCATGGCATCTCCACC-3 ') и MR / backbone / R (5'-GACCCGGGATACCGGGTTTCGG-3'). Два фрагмента были подвергнуты циркуляризации в присутствии смеси ферментов In-Fusion для создания MR с ориентацией отрицательной цепи.Этому способствовали гомологичные последовательности из 15 нуклеотидов, включенные в 5'-концы праймеров (подчеркнутые в последовательностях).

    Для создания плазмид для временной экспрессии белка M, M UAA , M RARA и мутантных белков M AAAA , а также белка sc4, последовательности кДНК этих генов были амплифицированы с помощью ПЦР. с использованием специфических праймеров (эти последовательности праймеров будут предоставлены по запросу). Затем полученные продукты ПЦР вставляли в бинарный вектор pGD (86) с помощью клонирования In-Fusion (Clontech).Плазмида pGD-CFP-M, используемая для временной экспрессии слияния CFP-M, была описана ранее (54) и использовалась для создания плазмид экспрессии pGD-CFP-M RARA и pGD-CFP-M AAAA .

    Чтобы обеспечить временную коэкспрессию вирусных белков и GFP, мы сначала сконструировали вектор двойной экспрессии pGD-X / GFP. Для этого мы линеаризовали вектор pGD-GFP (86) рестрикционным расщеплением MluI. Затем область, охватывающую промотор 35S, множественные сайты клонирования и последовательность терминатора Nos в векторе pGD, амплифицировали с помощью pGD / MluI 15 н / F (5'-CGAATTAATTACGCGTCATGGTGGAGCACGACACTCTCGT-3 ') и pGD / MluI 15 нт / R (5'-CTCCACCATGACGCGTCCCGATCTAGTAACATAGATGACA-3 ') праймеры.Продукт ПЦР был разработан так, чтобы иметь гомологичную последовательность из 15 нуклеотидов (подчеркнута) с концами линеаризованного вектора. Смесь для клонирования In-Fusion (Clontech) использовали для сборки продукта ПЦР и линеаризованного вектора in vitro . Кодирующие последовательности генов SYNV N, P, sc4, M и G амплифицировали с помощью ПЦР и индивидуально вставляли в сайт рестрикции XbaI pGD-X / GFP для создания соответствующих плазмид с двойной экспрессией.

    Для создания векторов BiFC кодирующие последовательности белка N, белка M дикого типа и мутантов M были слиты с N-концевым и C-концевым фрагментами усиленного гена YFP в векторах p2YN и p2YC. (87) с помощью процедуры, аналогичной процедуре Sun et al.(54).

    Анализы агроинфильтрации и агроинфекции. Анализы минирепликонов SYNV проводили путем инфильтрации тканей листа N. benthamiana штаммами Agrobacterium tumefaciens для доставки плазмиды pSYNV MR GFP-RFP , плазмиды pGD-NPL и плазмиды p19, γ Вирусные супрессоры P1 / HC-Pro экспрессионной плазмиды подавления РНК (VSR), как описано ранее (51, 88). Кроме того, штаммы агробактерий, содержащие отдельные плазмиды для экспрессии белков М дикого типа или мутировавших М или белка sc4, были смешаны с вышеупомянутыми смесями в соотношении 1: 6 (объем / объем) с общей оптической плотностью (OD ) А 600 из 0.7. Инфильтрованные листья наблюдали под флуоресцентным микроскопом через 8 дней после инфильтрации (dpi), чтобы проверить их влияние на экспрессию репортерного гена. Анализы репликона PVX-GFPΔp25 проводили аналогичным образом, за исключением того, что штаммы A. tumefaciens, несущие PVX-GFPΔp25, разбавляли в 250 раз и смешивали в соотношении 1: 1: 1 с культурами Agrobacterium , содержащими три вирусные плазмиды VSR (p19, γb и P1 / HC-Pro) (OD A 600 = 0,6) и белок SYNV M (OD A 600 = 0.3).

    Анализы на агроинфекцию

    SYNV проводили аналогично анализу агроинфильтрации минирепликонов (59), за исключением того, что штаммы агробактерий, несущие производные pSYNV-RFP или pSYNV-GFP, были заменены на штаммы, несущие плазмиду pSYNV MR GFP-RFP . Для тестирования SIE в экспериментах по смешанной агроинфекции штаммы агробактерий, несущие производные pSYNV-RFP и pSYNV-GFP, были смешаны в равных объемах перед инфильтрацией. Инфильтрованные листья наблюдали с помощью флуоресцентного микроскопа при 15 dpi и подсчитывали количество клеток на границах очагов, показывающих как GFP, так и RFP.Чтобы оценить влияние сверхэкспрессированных белков SYNV на локализованное распространение rSYNV-RFP, штаммы A. tumefaciens, индивидуально несущие плазмиды pGD для экспрессии белка SYNV N, P, sc4, M или G, были добавлены к агроинфекционным смесям в соотношении 1: 9 (объем / объем) с общим OD A 600 0,7. Инфильтрованные листья наблюдали с помощью флуоресцентного микроскопа при 8 dpi, а затем при 12 dpi, и подсчитывали количество клеток в каждом фокусе RFP.

    Чтобы оценить влияние белка SYNV M на локальное движение PVX-GFP, A.tumefaciens EHA 105, несущие PVX-GFP (OD A 600 = 1,0), разводили в 1000 раз и смешивали в соотношении 1: 1: 1 с культурами Agrobacterium , содержащими три вирусные плазмиды VSR (p19, γb, и P1 / HC-Pro) (OD A 600 = 0,6) и белок SYNV M (OD A 600 = 0,3). Площади очагов инфекции PVX-GFP с разрешением 6 dpi измеряли с помощью программного обеспечения LSM Zen 2012 (Carl Zeiss, Германия).

    Коробка передач механическая.Механическая передача SYNV осуществлялась, как описано ранее (89). Вкратце, молодые появляющиеся листья N. benthamiana (~ 2 г), системно инфицированные производными SYNV, измельчали ​​с 5 мл холодного (~ 4 ° C) инокуляционного буфера, содержащего 5% сульфита натрия (граммы / литр) и 2% целита ( граммов / литр), и полученный брей аккуратно втирали вручную в молодые разросшиеся листья 6-8-недельных растений N. benthamiana. Инокулированные растения помещали в камеры для выращивания в условиях окружающей среды, описанных выше.

    Анализ белка. Все образцы белка, разделенные с помощью 12% SDS-PAGE, окрашивали кумасси синим или переносили на нитроцеллюлозные мембраны и выявляли поликлональными антителами, специфичными к разрушенным вирионам SYNV (90) или белку sc4 (50). В некоторых случаях мембраны удаляли и повторно зондировали моноклональными антителами GFP и RFP (Abcam, Кембридж, Великобритания).

    Плазмиды

    BiFC.BiFC вводили индивидуально в штаммы A. tumefaciens EHA105 путем электропорации. Одинаковые объемы бактериальных культур ( А 600 = 0.5), несущие плазмиды на основе p2YN- и p2YC, смешивали и инфильтрировали в листья трансгенных растений N. benthamiana, экспрессирующих репортерный белок RFP-гистона 2B (RFP-h3B) (91). Сигналы YFP и RFP визуализировали через 36–48 ч после инфильтрации в расширенные листья и регистрировали с помощью конфокальной микроскопии Zeiss 780 (Carl Zeiss, Германия).

    Флуоресцентная микроскопия и конфокальная лазерная сканирующая микроскопия. Эпифлуоресцентный микроскоп (Zeiss SteREO Lumar V12) использовался для визуализации флуоресцентных фокусов SYNV MR и определения движения производных rSYNV и PVX-GFP в инфильтрированных тканях листа и системно инфицированных листьях.Флуоресценцию листьев N. benthamiana регистрировали с помощью набора фильтров Lumar 31 для обнаружения RFP (возбуждение, 565/30 нм; эмиссия, 620/60 нм) и набора фильтров Lumar 38 для обнаружения GFP (возбуждение, 470/40; излучение, 525/50). Визуализацию флуоресцентных белков с высоким разрешением выполняли с помощью конфокального микроскопа Zeiss 780. Флуоресценция GFP, RFP, YFP и CFP возбуждалась лазерными линиями с длиной волны 470, 545, 488 и 405 нм соответственно. Для экспериментов по коинфекции с использованием производных рекомбинантного вируса, экспрессирующих GFP или RFP, была получена серия от 7 до 11 z-стеков с использованием 20-кратного объектива (воздушный объектив NeoFluor; числовая апертура [NA], 0.50 [Zeiss]), охватывая примерно 18–30 мкм по оси z, с шагом 3 мкм. Все изображения обрабатывались с помощью программы LSM Zen 2012 (Carl Zeiss, Германия).

    Нозерн-гибридизация. Суммарная РНК была выделена из инфильтрированных областей листьев N. benthamiana с использованием реагента TRIzol (TaKaRa, Далянь, Китай), разделена в 1,5% агарозо-формальдегидных гелях и исследована с помощью меченного дигоксином комплементарного олигонуклеотидного зонда GFP (5 ' -CCTCGAACTTCACCTCGGCGCGGGTCTTGTAGTTGCCGTCGTCCTTGAAGAAGATGGTG-3 ') (Invitrogen, Шанхай, Китай).Блоты проявляли с использованием конъюгированных с пероксидазой хрена антител к дигоксину и хемилюминесцентных субстратов, доступных в стартовом наборе для метки и обнаружения ДНК DIG High Prime (Roche Diagnostics, Базель, Швейцария), и отображали их с помощью прибора для визуализации биомолекул ImageQuant LAS 4000 Mini (GE Здравоохранение, Литл-Чалфонт, Соединенное Королевство). Чтобы сгенерировать маркеры размера РНК для GFP и MR, мы амплифицировали кДНК с использованием пары праймеров T7GFPF (5'-TAATACGACTCACTATAGGGATGGTGAGCAAGGGCGAGGA-3 ') и GFPR (5'-TTACTTGTACAGCTCACGTCCATGAC-TAGACA-TCCATGAC-3) и пары ′) И MRR (5′-AGAGACAAAAGCTCAGAACAATCC-3 ′) соответственно.Прямые праймеры содержали промотор Т7, расположенный на 5'-конце (подчеркнут), и продукты ПЦР были транскрибированы in vitro с помощью РНК-полимеразы Т7, как описано ранее (88).

    БЛАГОДАРНОСТИ

    Мы благодарим Майкла Гудина (Университет Кентукки, США) за предоставление RFP-h3B трансгенных семян N. benthamiana и Фей Яна (Университет Нинбо, Китай) за предоставление конструкции PVX-GFPΔp25.

    Работа поддержана Национальным фондом естественных наук Китая (гранты 31671996 и 31870142).

    Мы заявляем, что у нас нет конфликта интересов.

    СНОСКИ

      • Получено 23 апреля 2019 г.
      • Принято 16 июля 2019 г.
      • Принятая рукопись размещена в Интернете 24 июля 2019 г.
    • Авторские права © Американское общество микробиологии, 2019 г.

    Рекомбинантный матричный белок 1 (His tag) (ab217650)

    Описание

    • Название продукта

      Рекомбинантный матричный белок 1 (His tag)

    • Чистота

    • Система выражений

      кишечная палочка

    • Присоединение

    • Длина белка

      Белок полной длины

    • Без животных

    • Природа

      Рекомбинантный

      • Последовательность

        MSLLTEVETYVLSIIPSGPLKAEIAQRLESVFAGKNTDLEALMEWLKTRP ILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDRAVKLY KKLKREITFHGAKEVSLSYSTGALASCMGLIYNRMGTVTTEAAFGLVCAT CEQIADSQHRSHRQMATTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAA EAMEVANQTRQMVHAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQR FK

      • Расчетная молекулярная масса

        28 кДа

      • Аминокислоты

        1 до 252

      • Теги

        Его тег C-Terminus

      • Дополнительная информация о последовательности

        Вирус гриппа A (A / California / 04/09) (h2N1).

    Технические характеристики

    Наша гарантия Abpromise распространяется на использование ab217650 в следующих протестированных приложениях.

    Примечания по применению включают рекомендуемые начальные разведения; Оптимальные разведения / концентрации должны определяться конечным пользователем.

    • Приложения

    • Форма

      Жидкость

    • Загрузка информации о концентрации...

    Подготовка и хранение

    • Стабильность и хранение

      Поставляется при 4 ° C. Хранить при -20 ° C. Избегайте цикла замораживания / оттаивания.

      Состав: 100% PBS

    Общая информация

    • Альтернативные названия

      • M1
      • Матричный белок 1
      • Матричный белок I
      • Белок мембранного матрикса M1
    • Релевантность

      Матричный белок вируса гриппа типа A, также известный как M1, состоит из 252 аминокислотной последовательности и является типоспецифичным для вирусов гриппа.Он расположен внутри липидной оболочки вируса и играет ключевую роль в сборке и репликации вируса. M1 можно изолировать от частиц, удалив оболочку с помощью детергентов и снизив pH до 4,0. Вирусы гриппа - распространенный и широко распространенный инфекционный агент. Как и многие другие вирусы, вирус гриппа постоянно мутирует, избегая, таким образом, иммунной системы. Белки вируса гриппа A M образуют непрерывную оболочку на внутренней стороне липидного бислоя, поддерживая структурную целостность вирусной частицы за счет гидрофобных взаимодействий.

    • Сотовая локализация

      Цитоплазматический

    Изображения

    • SDS-PAGE - Рекомбинантный матричный белок 1 (His tag) (ab217650)

      10% SDS-PAGE анализ ab217650.

    Протоколы

    Насколько нам известно, для этого продукта не требуются индивидуальные протоколы.


    Добавить комментарий

    Ваш адрес email не будет опубликован. Обязательные поля помечены *

    *
    *